KEGG   Mus musculus (mouse): 13836Help
Entry
13836             CDS       T01002                                 

Gene name
Epha2, AW545284, Eck, Myk2, Sek-2, Sek2
Definition
(RefSeq) Eph receptor A2 (EC:2.7.10.1)
  KO
K05103  
Eph receptor A2 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    13836 (Epha2)
   04015 Rap1 signaling pathway
    13836 (Epha2)
   04151 PI3K-Akt signaling pathway
    13836 (Epha2)
 Organismal Systems
  Development
   04360 Axon guidance
    13836 (Epha2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13836 (Epha2)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Eph family
   13836 (Epha2)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class VIII (EPH receptor family)
   13836 (Epha2)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   13836 (Epha2)
Cell adhesion molecules and their ligands [BR:mmu04516]
 7. Others
  EFNA; ephrin-A [KO:K05462]
   13836 (Epha2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 73.67 cM; 4 D-E
AA seq 977 aa AA seqDB search
MELRAVGFCLALLWGCALAAAAAQGKEVVLLDFAAMKGELGWLTHPYGKGWDLMQNIMDD
MPIYMYSVCNVVSGDQDNWLRTNWVYREEAERIFIELKFTVRDCNSFPGGASSCKETFNL
YYAESDVDYGTNFQKRQFTKIDTIAPDEITVSSDFEARNVKLNVEERMVGPLTRKGFYLA
FQDIGACVALLSVRVYYKKCPEMLQSLARFPETIAVAVSDTQPLATVAGTCVDHAVVPYG
GEGPLMHCTVDGEWLVPIGQCLCQEGYEKVEDACRACSPGFFKSEASESPCLECPEHTLP
STEGATSCQCEEGYFRAPEDPLSMSCTRPPSAPNYLTAIGMGAKVELRWTAPKDTGGRQD
IVYSVTCEQCWPESGECGPCEASVRYSEPPHALTRTSVTVSDLEPHMNYTFAVEARNGVS
GLVTSRSFRTASVSINQTEPPKVRLEDRSTTSLSVTWSIPVSQQSRVWKYEVTYRKKGDA
NSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSTEGSANMAVIG
GVAVGVVLLLVLAGVGLFIHRRRRNLRARQSSEDVRFSKSEQLKPLKTYVDPHTYEDPNQ
AVLKFTTEIHPSCVARQKVIGAGEFGEVYKGTLKASSGKKEIPVAIKTLKAGYTEKQRVD
FLSEASIMGQFSHHNIIRLEGVVSKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGM
LRGIASGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKI
PIRWTAPEAISYRKFTSASDVWSYGIVMWEVMTYGERPYWELSNHEVMKAINDGFRLPTP
MDCPSAIYQLMMQCWQQERSRRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIRLPSTS
GSEGVPFRTVSEWLESIKMQQYTEHFMVAGYTAIEKVVQMSNEDIKRIGVRLPGHQKRIA
YSLLGLKDQVNTVGIPI
NT seq 2934 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggcagtcggtttctgcctggcgctgctgtggggttgcgcgctggcggcc
gcggcggcacagggaaaggaagttgttttgttggacttcgcagcaatgaagggagagctc
ggctggctcacgcacccctatggcaaagggtgggacctgatgcagaacatcatggacgac
atgcctatctacatgtactcggtgtgcaacgtggtatccggcgaccaggacaactggctc
cgcaccaactgggtgtaccgggaggaggccgagcgcatctttattgagctcaagttcacg
gtgcgagactgtaacagcttcccgggtggcgccagctcatgcaaagagaccttcaacctc
tactatgcagagtcagatgtggactatggcaccaacttccagaagcgccagttcaccaag
attgacaccatcgcccctgacgagatcacggtcagcagtgacttcgaggctcgcaatgtc
aagctgaacgtagaggagcgcatggtggggccccttacccggaagggcttctacctggcc
ttccaggacatcggcgcctgcgtggcgctgctctccgttcgcgtctactacaagaagtgt
cccgagatgctgcagagcttggctcgcttccccgagaccattgctgtcgctgtctccgat
acacaacccctggccacggtggccggtacctgcgtggaccatgccgtggtgccttatggg
ggcgaggggcctctcatgcactgcacggtggatggcgagtggctggtgcccatcgggcag
tgcctgtgccaggaaggctacgagaaggtcgaggatgcctgccgagcctgttctccagga
ttcttcaagtctgaggcatctgagagcccttgcctggagtgtccagagcataccctgcca
tccacagagggtgccacctcctgccagtgtgaagaaggctatttcagggcacctgaggac
ccactgtccatgtcttgcacacgtccaccctctgcccccaactacctcacggccattggc
atgggtgccaaagtagaactgcgttggacagctcccaaggacactggtggccgccaggac
attgtctacagtgtcacttgcgaacagtgctggccagagtctggcgagtgtgggccctgt
gaggcgagcgtgcgctattcagaacctcctcacgccctgacccgcacgagtgtgacagtc
agtgacctggagccccacatgaactataccttcgctgtcgaagcacgcaatggtgtctca
ggcctggtgactagccgaagcttccggactgccagcgtcagtattaaccaaacagagccc
cccaaagtgaggctggaggaccgaagcaccacctccctgagtgtcacctggagcatcccg
gtgtcacagcagagccgtgtgtggaagtacgaagtcacctaccgcaagaagggggatgcc
aacagctataatgtgcgccgcacggaaggcttctccgtgaccctggatgaccttgctccg
gataccacgtacctggtgcaggtgcaggcgctgacgcaggagggccagggagccggcagc
aaagtgcacgagttccagacactgtccacggaaggatctgccaacatggcggtgatcggc
ggtgtggctgtaggtgttgttttgcttctggtactggcaggagttggcctcttcatccat
cgaaggaggaggaacctgcgggctcgccagtcctctgaggatgtccgtttttccaagtca
gaacaactaaagcccctgaagacctatgtggatcctcacacttacgaagaccccaaccag
gctgtactcaagtttaccaccgagatccacccatcctgtgtggcaaggcagaaggtcatt
ggagcaggagagtttggagaggtctataaagggacgctgaaggcatcctcggggaagaag
gagataccggtggccatcaagacactgaaagcgggctacactgagaagcagcgggtggac
ttcctgagcgaggccagcatcatgggccagtttagccaccacaatatcatccgcctggag
ggcgtggtctctaaatacaaacccatgatgattatcacagagtacatggagaatggagcg
ctagacaagttccttagggagaaggatggtgagttcagtgtacttcagttggtgggcatg
ctgaggggtatcgcatccggcatgaagtacctggccaacatgaactacgtgcaccgggac
ctggccgcccgcaacatcctcgtcaacagcaacctggtgtgcaaggtgtccgattttggc
ctgtcgcgtgtgctggaagatgaccccgaggccacctacaccacaagtggcggcaagatc
cctattcgatggacagccccagaggccatttcctaccgcaagttcacctcagccagcgat
gtgtggagctacggcattgtcatgtgggaagtgatgacttatggcgaacggccctactgg
gaactgtcaaaccacgaggtcatgaaagccatcaacgacggcttccggctccctacgccc
atggactgcccttcagccatttaccagctcatgatgcagtgctggcagcaagagcgctcc
cgccgacccaagtttgccgacatcgttagcatcctggacaagctcatccgagcccccgac
tccctcaagacgctggctgactttgatccccgagtgtccatccggctgcccagcaccagc
ggctcggagggagtccccttccgtacggtgtccgagtggctggagagcatcaagatgcaa
cagtacacggaacacttcatggtggctggctacacggccatcgagaaggtggtacagatg
tccaacgaagacatcaaaaggatcggagtgcgtcttcctggccaccagaagcgtattgcc
tacagcctgctgggactcaaggaccaggtcaacacagtggggattcctatctga

DBGET integrated database retrieval system