KEGG   Mus musculus (mouse): 13842Help
Entry
13842             CDS       T01002                                 

Gene name
Epha8, AW047546, Eek, Hek3, mKIAA1459
Definition
(RefSeq) Eph receptor A8 (EC:2.7.10.1)
  KO
K05109  
Eph receptor A8 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Axon guidance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Development
   04360 Axon guidance
    13842 (Epha8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     13842 (Epha8)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Eph family
   13842 (Epha8)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class VIII (EPH receptor family)
   13842 (Epha8)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class VIII (EPH receptor family)
   13842 (Epha8)
Cell adhesion molecules and their ligands [BR:mmu04516]
 7. Others
  EFNA; ephrin-A [KO:K05462]
   13842 (Epha8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 D3
AA seq 1004 aa AA seqDB search
MAPARARLSPALWVVTAAAAATCVSAGRGEVNLLDTSTIHGDWGWLTYPAHGWDSINEVD
ESFRPIHTYQVCNVMSPNQNNWLRTNWVPRDGARRVYAEIKFTLRDCNSIPGVLGTCKET
FNLHYLESDRDLGASTQESQFLKIDTIAADESFTGADLGVRRLKLNTEVRGVGPLSKRGF
YLAFQDIGACLAILSLRIYYKKCPAMVRNLAAFSEAVTGADSSSLVEVRGQCVRHSEERD
TPKMYCSAEGEWLVPIGKCVCSAGYEERRDACMACELGFYKSAPGDQLCARCPPHSHSAT
PAAQTCRCDLSYYRAALDPPSAACTRPPSAPVNLISSVNGTSVTLEWAPPLDPGGRSDIT
YNAVCRRCPWALSHCEACGSGTRFVPQQTSLAQASLLVANLLAHMNYSFWIEAVNGVSNL
SPEPRSAAVVNITTNQAAPSQVVVIRQERAGQTSVSLLWQEPEQPNGIILEYEIKYYEKD
KEMQSYSTLKAVTTRATVSGLKPGTRYVFQVRARTSAGCGRFSQAMEVETGKPRPRYDTR
TIVWICLTLITGLVVLLLLLICKKRHCGYSKAFQDSDEEKMHYQNGQAPPPVFLPLNHPP
GKFPETQFSAEPHTYEEPGRAGRSFTREIEASRIHIEKIIGSGESGEVCYGRLQVPGQRD
VPVAIKALKAGYTERQRQDFLSEAAIMGQFDHPNIIRLEGVVTRGRLAMIVTEYMENGSL
DAFLRTHDGQFTIVQLVGMLRGVGAGMRYLSDLGYIHRDLAARNVLVDGRLVCKVSDFGL
SRALEDDPEAAYTTAGGKIPIRWTAPEAIAFRTFSSASDVWSFGVVMWEVLAYGERPYWN
MTNQDVISSVEEGYRLPAPMGCPRALHQLMLDCWHKDRAQRPRFAHVVSVLDALVHSPES
LRATATVSRCPPPAFARSCFDLRAGGSGNGDLTVGDWLDSIRMGRYRDHFAAGGYSSLGM
VLRMNAQDVRALGITLMGHQKKILGSIQTMRAQLSSTQGPRRHL
NT seq 3015 nt NT seq  +upstreamnt  +downstreamnt
atggcccccgcccgggcccgcctgtcccccgctctctgggtcgtcacggccgcggcggcg
gccacctgcgtgtccgcggggcgcggcgaagtgaacttgttggatacatcaaccatccac
ggagactggggctggctcacgtatcccgctcatgggtgggactccatcaacgaggtagac
gagtccttccggcccatccacacgtaccaagtatgcaacgtcatgagccccaaccagaac
aactggctgcgcacgaactgggtgccccgcgacggcgccaggcgtgtctacgccgagatc
aaattcaccctgcgtgactgcaatagcatcccaggggtgttaggtacctgcaaggagacc
ttcaaccttcactacctggagtctgaccgcgacctgggggccagcacacaagagagccag
ttcctcaagattgacaccatcgcggcggatgagagcttcacgggcgcagacctgggtgtg
cggaggctcaagctgaacacggaggtgcgtggcgtgggcccgctcagcaagcgcggcttc
tacctggccttccaggacataggtgcctgcctcgccatcctctcactccgaatctactac
aagaagtgccccgccatggtacgcaacctggcagccttctcggaggcggttactggggcc
gactcgtcctcgctggttgaggttcgaggccagtgtgtgcggcactcggaagagcgcgac
acacccaagatgtactgcagtgctgagggcgaatggctggtgcccatcggcaagtgcgtg
tgcagtgctggctatgaggagcggcgggatgcctgcatggcctgtgagctgggcttctac
aagtcagcccccggggaccagctgtgcgcccgatgcccaccccacagccactctgccacc
cctgcggcccagacctgccgttgtgacctcagctactaccgcgcggccttggacccacca
tcggcagcctgcacccggccaccctcagcaccagtgaacctgatctccagcgtaaatgga
acgtctgtgaccctcgagtgggcccctcctctggacccaggtggtcgcagcgacatcacc
tacaacgcagtgtgccgccgctgcccctgggccctgagccactgtgaggcttgtgggagt
ggaactcgcttcgtcccgcagcagacaagcctggcacaggccagcctgctggtggccaac
ctgctagcccacatgaactactccttctggatcgaggcagtcaacggtgtctccaacctg
agccctgagccccgcagcgctgctgtggtcaacatcaccacgaaccaggcagccccgtcc
caggtggtggtgatccggcaggagcgggctgggcagaccagcgtgtcactcctgtggcag
gaaccagagcagcccaacggcatcattctggagtacgagatcaagtactacgagaaggat
aaggagatgcaaagttactctaccctcaaggctgtcaccacccgcgccaccgtgtcaggc
ctcaaaccaggcactcgctacgtgttccaggtccgagcccgcacctcagcaggctgtggc
cgcttcagccaggccatggaggtggagaccgggaaacccaggccccgctacgacactcgg
accatcgtctggatctgcctgacactcatcacgggcctggtggtgctcctcttgcttctc
atctgcaagaagaggcactgtggctacagcaaggcgttccaggactcggatgaagagaag
atgcattaccagaacgggcaggcacccccacctgtcttcttgcccttgaaccaccccccg
gggaagttcccagaaacccagttctctgcagagccccacacctatgaggaaccaggtcgg
gcaggccggagctttacccgagagatcgaggcatccaggatccacattgagaagatcata
ggctcgggggagtcaggagaagtgtgctatgggaggctgcaggtgccaggacagcgcgat
gtgcctgtggccatcaaggctctcaaagctggctacacggagagacagcgacaagacttc
ttgagcgaggcagccatcatgggccaatttgatcaccctaacatcatccgccttgagggt
gtggtcacccgtggtcgcctggcaatgattgtgacggagtacatggaaaatggctctctg
gatgccttcctcaggacccacgatgggcagttcaccatcgtgcagctagtgggcatgctc
agaggggtgggcgctggcatgcgctacctctcagacctgggctacattcaccgtgacctg
gctgcccgcaatgtcctggtggatggccgtctggtgtgcaaagtgtcagactttgggctc
tcaagggctctggaggatgaccccgaagctgcctacaccactgcgggagggaagatccct
atccgatggacagcgccggaggccattgctttccgcacgttctcctcagccagtgatgtg
tggagctttggtgtggtcatgtgggaggttctagcctatggtgaacgaccctactggaac
atgaccaaccaggatgtcatcagctctgtggaggagggttataggctgccagcacccatg
ggttgcccacgtgccctacaccagctcatgctggactgctggcacaaggaccgtgcccag
cggcctcgcttcgctcatgtcgtgagcgttctggatgccctggtccacagtcctgagagc
ctcagggccacagccacagtcagcaggtgcccaccccctgccttcgccaggagctgcttt
gacctccgagcaggcggaagtgggaacggggacctcacagtgggggactggctggactcc
atccgaatggggcgctaccgggaccacttcgcggctggcgggtactcctccctcggcatg
gtgcttcggatgaacgcccaggatgtgcgcgccctcggcatcactctcatgggtcaccag
aagaagatacttggaagcatccagaccatgagggcccagctgagcagcacccagggaccc
cgccggcacctctga

DBGET integrated database retrieval system