KEGG   Mus musculus (mouse): 13854Help
Entry
13854             CDS       T01002                                 

Gene name
Epn1, AA269831, Ibp1
Definition
(RefSeq) epsin 1
  KO
K12471  
epsin
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    13854 (Epn1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    13854 (Epn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7; 7 A1
AA seq 575 aa AA seqDB search
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDVQLQLALSLSREEHDKEERIRRGDDLRLQM
AIEESKRETGGKEESSLMDLADVFTTPAPPQASDPWGGPASVPTAVPVAAAASDPWGGPA
VPPAADPWGGAAPTPASGDPWRPAAPTGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGAPV
SGPPSSDPWAPAPAFSDPWGGSPAKPSSNGTAVGGFDTEPDEFSDFDRLRTALPTSGSST
GELELLAGEVPARSPGAFDMSGVGGSLAESVGSPPPAATPTPTPPTRKTPESFLGPNAAL
VDLDSLVSRPGPTPPGSKASNPFLPSGAPPTGPSVTNPFQPAPPATLTLNQLRLSPVPPV
PGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcatcgctgcggcgtcagatgaagaatatcgtccacaactactcagaggct
gagatcaaggtccgcgaggccacaagcaatgatccctggggcccatccagctccctcatg
tcagagattgctgacctcacctacaatgttgtggccttctccgagatcatgagcatgatc
tggaagcggctcaatgaccacggcaagaactggaggcacgtctacaaggccatgacgttg
atggagtacctcatcaagactggctctgagcgtgtatcacaacagtgcaaagagaacatg
tatgctgtgcagacgctgaaggacttccagtatgtggaccgtgatggcaaggaccagggt
gtgaatgtgcgggagaaggccaagcagctggtggctttgctgcgtgatgaggatcggctc
cgggaggagcgcgcccacgcgctcaagaccaaggagaagctggcacagactgccacggcc
tcctcagcagccgtgggctctggaccacctcccgaggcggagcaggcatggccacagagc
agcggggaggaggagttgcagctccagctggccctggctatgagcaaggaggaggccgac
cagcccccgtcctgcggccctgaggatgacgtccagctccagctggcccttagtttgagc
cgagaggagcacgataaggaagagcggatccgtcgtggggatgacctgaggctgcagatg
gcaatagaggagagcaagagggagactgggggcaaggaggagtcatctctcatggatctt
gctgatgtcttcacaaccccagcgcctccacaggcctcagacccttgggggggcccggca
tctgtgcctactgctgtccctgtggctgctgccgcttcagacccttgggggggacctgct
gtccctccagctgctgatccttggggtggtgcagcccccacaccagcctcaggggatccc
tggaggcctgcagcccctacagggccctctgttgatccttggggtgggaccccagctcct
gcagctggagaggggcccacccctgacccgtggggaagctctgatggtggggctcctgtc
agtgggcccccatcttctgacccctgggcacctgccccggctttctcagacccctgggga
ggctcacctgcaaagcccagcagcaacggcactgcagttgggggctttgacacagagcct
gatgagttctcagacttcgaccgactccgcactgccctgccaacctctgggagcagcacg
ggggagttggagttgctcgcaggagaggtgcctgctcgcagccctggggcattcgacatg
agtggggttgggggatctctggctgagtctgtggggagtcccccacctgctgcaacccca
actcccacccccccaacacggaagactccggagtcattcctaggccctaatgcagccctt
gtggatctggactcgctggtgagccgaccaggccccacaccaccaggatccaaggcttcc
aacccattccttccaagcggagctccgcccacaggcccctctgtcaccaatcctttccag
ccagcaccccctgcaacgctcaccctgaaccagctccgtctcagtcctgtgcccccagtt
cctggagcgccacccacctacatctctcctcttggtggaggccctggcctgccccccatg
atgcccccaggtcccccagcccccaacactaaccccttcctcctataa

DBGET integrated database retrieval system