KEGG   Mus musculus (mouse): 13884Help
Entry
13884             CDS       T01002                                 

Gene name
Ces1c, Ces-N, Ee-1, Ee1, Es-4, Es-N, Es1, Es4, EsN, PESN
Definition
(RefSeq) carboxylesterase 1C
  KO
K01044  carboxylesterase 1 [EC:3.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00983  Drug metabolism - other enzymes
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    13884 (Ces1c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     13884 (Ces1c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COesterase Abhydrolase_3 Peptidase_S9 Esterase
Motif
Other DBs
NCBI-GeneID: 13884
NCBI-ProteinID: NP_031980
MGI: 95420
Ensembl: ENSMUSG00000057400
Vega: OTTMUSG00000024453
UniProt: P23953
Position
8 C5; 8 44.99 cM
AA seq 554 aa AA seqDB search
MWLHALVWASLAVCPILGHSLLPPVVDTTQGKVLGKYISLEGFEQPVAVFLGVPFAKPPL
GSLRFAPPQPAEPWSFVKNATSYPPMCSQDAGWAKILSDMFSTEKEILPLKISEDCLYLN
IYSPADLTKSSQLPVMVWIHGGGLVIGGASPYNGLALSAHENVVVVTIQYRLGIWGLFST
GDEHSPGNWAHLDQLAALRWVQDNIANFGGNPDSVTIFGESSGGISVSVLVLSPLGKDLF
HRAISESGVVINTNVGKKNIQAVNEIIATLSQCNDTSSAAMVQCLRQKTESELLEISGKL
VQYNISLSTMIDGVVLPKAPEEILAEKSFNTVPYIVGFNKQEFGWIIPMMLQNLLPEGKM
NEETASLLLRRFHSELNISESMIPAVIEQYLRGVDDPAKKSELILDMFGDIFFGIPAVLL
SRSLRDAGVSTYMYEFRYRPSFVSDKRPQTVEGDHGDEIFFVFGAPLLKEGASEEETNLS
KMVMKFWANFARNGNPNGEGLPHWPEYDEQEGYLQIGATTQQAQRLKAEEVAFWTELLAK
NPPETDPTEHTEHK
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtggctccatgctctggtctgggcttctcttgctgtttgcccaattctgggacactca
ctcttaccacctgtggtggacaccacacaaggcaaagtcctggggaagtatatcagctta
gaaggatttgaacagcctgtggccgtcttcctgggagtcccctttgccaagccccctctt
ggatctctgaggtttgctccaccacagcctgcagagccctggagcttcgtgaagaatgcc
acctcctaccctcctatgtgctcccaagatgcaggttgggcaaagatactctcagatatg
ttcagcaccgaaaaggagatcctgcctctcaagatttcggaagactgtctctacctgaat
atttacagtcctgccgatttgacaaaaagcagccaattgcctgtgatggtgtggatccat
ggaggtggactggtgataggcggagcatcaccctataatggactagctctctctgcccat
gagaacgtggtggtagtaaccattcaataccgcctgggtatttggggattatttagcaca
ggtgatgaacacagcccaggaaactgggctcacctggaccaactggctgcactacgctgg
gtccaagataacattgcaaactttggagggaacccggattccgtgaccatctttggagag
tcatcagggggtatcagtgtctctgtccttgtcttatctcctctgggcaaggacctcttc
cacagagccatttctgagagtggtgtggtcataaatacaaacgtgggcaagaagaatata
caggctgtgaatgaaataatagctactctttcccagtgtaatgacacctcatcagctgcc
atggttcagtgcttgcgccagaagacagagagtgagctcttggagatttcagggaaactg
gtacagtacaatatctccctgtccaccatgattgacggagtggtgctgccaaaggcacca
gaagagatcctggctgagaagagtttcaacactgtcccctacatagtgggcttcaacaag
caagagtttggctggataattccaatgatgttgcaaaatctactccctgaaggcaaaatg
aatgaggaaacggccagtcttctcttgaggaggttccactctgaacttaacatctctgaa
agtatgattccagcagtcattgagcagtacttaagaggggtagatgaccctgccaaaaag
agtgagcttatcctggacatgtttggagatatattttttggtatcccggctgtgctcttg
tcccgtagcctcagagatgctggagtgtccacctacatgtatgagtttcggtatcgccca
agcttcgtgtctgacaagagaccccagacggttgagggtgatcatggcgatgaaatcttc
tttgtattcggggctccactattaaaagagggtgcctcagaagaggaaaccaacctcagc
aagatggtgatgaaattctgggccaactttgctcgaaatgggaaccctaatggggagggg
ctgcctcactggccagaatatgatgagcaggaagggtatctacagattggagccactacc
cagcaagcccagagactgaaagcagaggaagtggctttctggactgagctcctggctaag
aatccacctgagacagaccctactgaacacacagaacacaaatga

DBGET integrated database retrieval system