KEGG   Mus musculus (mouse): 13897Help
Entry
13897             CDS       T01002                                 

Gene name
Ces1e, Eg, Es-22, Es22, egasyn
Definition
carboxylesterase 1E (EC:3.1.1.1)
Orthology
K01044  
carboxylesterase 1 [EC:3.1.1.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Drug metabolism - other enzymes
Metabolic pathways
Class
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:mmu00983]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
8 C5; 8 45.11 cM
AA seq 562 aa AA seqDB search
MCLSALILVSLAAFTAGAGHPSSPPMVDTVQGKVLGKYISLEGFTQPVAVFLGVPFAKPP
LGSLRFAPPQPAEPWSSVKNATSYPPMCFQDPVTGQIVNDLLTNRKEKIPLQFSEDCLYL
NIYTPADLTKSDRLPVMVWIHGGGLVLGGASTYDGLVLSTHENVVVVVIQYRLGIWGFFS
TGDEHSRGNWGHLDQVAALHWVQDNIAKFGGDPGSVTIFGESAGGESVSVLVLSPLAKNL
FQRAISESGVALTAGLVKKNTRPLAEKIAVISGCKNTTSAAMVHCLRQKTEEELLGTTLK
LNLFKLDLHGDSRQSHPFVPTVLDGVLLPKMPEEILAEKNFNTVPYIVGINKQEFGWILP
TMMNYPPSDVKLDQMTAMSLLKKSSFLLNLPEDAIAVAIEKYLRDKDYTGRNKDQLLELI
GDVVFGVPSVIVSRGHRDAGAPTYMYEFQYSPSFSSEMKPDTVVGDHGDEIYSVFGAPIL
RGGTSEEEINLSKMMMKFWANFARNGNPNGQGLPHWPEYDQKEGYLQIGATTQQAQKLKE
KEVAFWTELLAKKQLPTEHTEL
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgtgcctctctgctctgatcctggtgtcacttgcagcattcacagcaggggcaggacat
ccatcctcaccacccatggtggacaccgtgcaaggcaaagtcctggggaagtacatcagc
ttagaaggattcacacagcctgtggccgtcttcctgggagtcccctttgccaagccccct
cttggatctctgaggtttgctccaccacagcctgcagagccctggagctccgtgaagaat
gccacctcctaccctcctatgtgcttccaagacccagtgacagggcaaatagtcaatgac
ctcctaactaacagaaaggagaaaattcctctccagttttctgaagactgtctctacctg
aatatttacactccagctgacttgacaaagagtgacagattgccagtgatggtgtggatc
catggaggtggactagtgttaggtggggcatcaacctatgatggactggtcctgtctacg
catgaaaatgtcgtggtggtggtcatccaataccgtttgggcatctggggattcttcagc
acaggggatgaacacagcagggggaactggggtcacttggaccaggtggctgcactacac
tgggtccaggacaacattgctaaatttggaggtgacccaggctctgtgaccatctttgga
gagtcagcaggaggtgaaagtgtctctgttcttgtgttgtctcccttggccaagaatctc
ttccagagggctatttctgaaagtggtgtggccctcactgcaggcctggtcaagaagaac
accaggcctttggctgagaaaattgctgtcatatctggttgtaaaaacaccacttccgct
gccatggttcactgccttcgccagaagacagaggaagagctcttggggaccacactaaaa
ttgaatctttttaagctggatttgcatggagactccagacagagccatccctttgttccc
actgtgcttgatggagtgttgctgccaaagatgcctgaggagatcctggctgagaagaac
ttcaacacagtgccctacatcgtgggaatcaacaagcaagagtttggctggattctgcca
actatgatgaactacccaccctctgatgtgaaattggaccagatgacggccatgtctctc
ttgaagaagtcctcttttcttcttaacctccctgaggatgcaattgcagtggccattgag
aagtatttaagagataaagattacacaggcagaaataaagaccaacttctggaattgatt
ggggatgtggtattcggtgtaccatctgtgattgtgtcccgtggacatagagatgccgga
gcccccacatacatgtatgagtttcaatatagtccaagcttctcgtcagaaatgaaacca
gatacggtggtaggagaccatggagatgaaatctactctgtctttggggccccaatttta
agaggtggtacctcagaagaggagatcaacctcagcaagatgatgatgaaattctgggcc
aactttgctaggaatgggaatcccaatggacaagggctgccccattggccagagtatgac
caaaaggaaggttatctgcagattggagccaccacccaacaagcccagaagctgaaagaa
aaagaagtggctttctggactgaacttctggctaagaagcaactgccgacagaacacact
gagctgtga

DBGET integrated database retrieval system