KEGG   Mus musculus (mouse): 13982Help
Entry
13982             CDS       T01002                                 

Gene name
Esr1, ER, ER-alpha, ERa, ERalpha, ESR, Estr, Estra, Nr3a1
Definition
(RefSeq) estrogen receptor 1 (alpha)
  KO
K08550  
estrogen receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Endocrine resistance
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Pathways in cancer
Proteoglycans in cancer
Breast cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    13982 (Esr1)
   04917 Prolactin signaling pathway
    13982 (Esr1)
   04919 Thyroid hormone signaling pathway
    13982 (Esr1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    13982 (Esr1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    13982 (Esr1)
   05205 Proteoglycans in cancer
    13982 (Esr1)
   05224 Breast cancer
    13982 (Esr1)
  Drug resistance
   01522 Endocrine resistance
    13982 (Esr1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    13982 (Esr1)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3A. Estrogen receptor
   13982 (Esr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 A1; 10 2.03 cM
AA seq 599 aa AA seqDB search
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAY
EFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQ
LSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIM
ESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKS
CQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPL
VIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVH
MINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGK
CVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIH
RVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPL
YDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacccttcacaccaaagcctcgggaatggccttgctgcaccagatccaaggg
aacgagctggagcccctcaaccgcccgcagctcaagatgcccatggagagggccctgggc
gaggtatacgtggacaacagcaagcccactgtgttcaactaccccgagggcgccgcctac
gagttcaacgccgccgccgccgccgccgccgccgcctcggcgccggtctacggccagtcg
ggcatcgcctacggccccgggtcggaggcggccgccttcagtgccaacagcctgggggct
ttcccccagctcaacagcgtgtcgcctagcccgctgatgctgctgcacccgccgccgcag
ctgtctcctttcctgcacccgcacggccagcaggtgccctactacctggagaacgagccc
agcgcctacgccgtgcgcgacaccggccctcccgccttctacaggtctaattctgacaat
cgacgccagaatggccgagagagactgtccagcagtaacgagaaaggaaacatgatcatg
gagtctgccaaggagactcgctactgtgccgtgtgcaatgactatgcctctggctaccat
tatggggtctggtcctgcgaaggctgcaaggctttctttaagagaagcattcaaggacac
aatgactacatgtgtccagctacaaaccaatgcaccattgacaagaaccggaggaagagt
tgccaggcctgtcggctgcgcaagtgttacgaagtgggcatgatgaaaggcggcatacgg
aaagaccgccgaggagggagaatgttgaagcacaagcgtcagagagatgacttggaaggc
cgaaatgaaatgggtgcttcaggagacatgagggctgccaacctttggccaagccctctt
gtgattaagcacactaagaagaatagccctgccttgtccttgacagctgaccagatggtc
agtgccttgttggatgctgaaccgcccatgatctattctgaatatgatccttctagaccc
ttcagtgaagcctcaatgatgggcttattgaccaacctagcagatagggagctggttcat
atgatcaactgggcaaagagagtgccaggctttggggacttgaatctccatgatcaggtc
caccttctcgagtgtgcctggctggagattctgatgattggtctcgtctggcgctccatg
gaacacccggggaagctcctgtttgctcctaacttgctcctggacaggaatcaaggtaaa
tgtgtggaaggcatggtggagatctttgacatgttgctggctacgtcaagtcggttccgc
atgatgaacctgcagggagaagagtttgtgtgcctcaaatccatcattttgcttaattcc
ggagtgtacacgtttctgtccagcaccttgaagtctctggaagagaaggaccacatccac
cgtgtcctggacaagatcacagacactttgatccacctgatggccaaagctggcctgact
ctgcagcagcagcatcgccgcctagctcagctccttctcattctttcccatatccggcac
atgagtaacaaaggcatggagcatctctacaacatgaaatgcaagaacgttgtgcccctc
tatgacctgctcctggagatgttggatgcccaccgccttcatgccccagccagtcgcatg
ggagtgcccccagaggagcccagccagacccagctggccaccaccagctccacttcagca
cattccttacaaacctactacatacccccggaagcagagggcttccccaacacgatctga

DBGET integrated database retrieval system