KEGG   Mus musculus (mouse): 13982Help
Entry
13982             CDS       T01002                                 

Gene name
Esr1, ER, ER-alpha, ERa, ERalpha, ESR, Estr, Estra, Nr3a1
Definition
(RefSeq) estrogen receptor 1 (alpha)
  KO
K08550  
estrogen receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Estrogen signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    13982 (Esr1)
   04917 Prolactin signaling pathway
    13982 (Esr1)
   04919 Thyroid hormone signaling pathway
    13982 (Esr1)
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    13982 (Esr1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    13982 (Esr1)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 estrogen-like
    13982 (Esr1)
Nuclear receptors [BR:mmu03310]
 3. Estrogen like
  3A. Estrogen receptor
   13982 (Esr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 A1; 10 2.03 cM
AA seq 599 aa AA seqDB search
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKMPMERALGEVYVDNSKPTVFNYPEGAAY
EFNAAAAAAAAASAPVYGQSGIAYGPGSEAAAFSANSLGAFPQLNSVSPSPLMLLHPPPQ
LSPFLHPHGQQVPYYLENEPSAYAVRDTGPPAFYRSNSDNRRQNGRERLSSSNEKGNMIM
ESAKETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKS
CQACRLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDLEGRNEMGASGDMRAANLWPSPL
VIKHTKKNSPALSLTADQMVSALLDAEPPMIYSEYDPSRPFSEASMMGLLTNLADRELVH
MINWAKRVPGFGDLNLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGK
CVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIH
RVLDKITDTLIHLMAKAGLTLQQQHRRLAQLLLILSHIRHMSNKGMEHLYNMKCKNVVPL
YDLLLEMLDAHRLHAPASRMGVPPEEPSQTQLATTSSTSAHSLQTYYIPPEAEGFPNTI
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgacccttcacaccaaagcctcgggaatggccttgctgcaccagatccaaggg
aacgagctggagcccctcaaccgcccgcagctcaagatgcccatggagagggccctgggc
gaggtatacgtggacaacagcaagcccactgtgttcaactaccccgagggcgccgcctac
gagttcaacgccgccgccgccgccgccgccgccgcctcggcgccggtctacggccagtcg
ggcatcgcctacggccccgggtcggaggcggccgccttcagtgccaacagcctgggggct
ttcccccagctcaacagcgtgtcgcctagcccgctgatgctgctgcacccgccgccgcag
ctgtctcctttcctgcacccgcacggccagcaggtgccctactacctggagaacgagccc
agcgcctacgccgtgcgcgacaccggccctcccgccttctacaggtctaattctgacaat
cgacgccagaatggccgagagagactgtccagcagtaacgagaaaggaaacatgatcatg
gagtctgccaaggagactcgctactgtgccgtgtgcaatgactatgcctctggctaccat
tatggggtctggtcctgcgaaggctgcaaggctttctttaagagaagcattcaaggacac
aatgactacatgtgtccagctacaaaccaatgcaccattgacaagaaccggaggaagagt
tgccaggcctgtcggctgcgcaagtgttacgaagtgggcatgatgaaaggcggcatacgg
aaagaccgccgaggagggagaatgttgaagcacaagcgtcagagagatgacttggaaggc
cgaaatgaaatgggtgcttcaggagacatgagggctgccaacctttggccaagccctctt
gtgattaagcacactaagaagaatagccctgccttgtccttgacagctgaccagatggtc
agtgccttgttggatgctgaaccgcccatgatctattctgaatatgatccttctagaccc
ttcagtgaagcctcaatgatgggcttattgaccaacctagcagatagggagctggttcat
atgatcaactgggcaaagagagtgccaggctttggggacttgaatctccatgatcaggtc
caccttctcgagtgtgcctggctggagattctgatgattggtctcgtctggcgctccatg
gaacacccggggaagctcctgtttgctcctaacttgctcctggacaggaatcaaggtaaa
tgtgtggaaggcatggtggagatctttgacatgttgctggctacgtcaagtcggttccgc
atgatgaacctgcagggagaagagtttgtgtgcctcaaatccatcattttgcttaattcc
ggagtgtacacgtttctgtccagcaccttgaagtctctggaagagaaggaccacatccac
cgtgtcctggacaagatcacagacactttgatccacctgatggccaaagctggcctgact
ctgcagcagcagcatcgccgcctagctcagctccttctcattctttcccatatccggcac
atgagtaacaaaggcatggagcatctctacaacatgaaatgcaagaacgttgtgcccctc
tatgacctgctcctggagatgttggatgcccaccgccttcatgccccagccagtcgcatg
ggagtgcccccagaggagcccagccagacccagctggccaccaccagctccacttcagca
cattccttacaaacctactacatacccccggaagcagagggcttccccaacacgatctga

DBGET integrated database retrieval system