KEGG   Mus musculus (mouse): 14062Help
Entry
14062             CDS       T01002                                 

Gene name
F2r, AI482343, Cf2r, Par1, ThrR
Definition
(RefSeq) coagulation factor II (thrombin) receptor
  KO
K03914  
coagulation factor II (thrombin) receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Calcium signaling pathway
cAMP signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Endocytosis
PI3K-Akt signaling pathway
Complement and coagulation cascades
Platelet activation
Regulation of actin cytoskeleton
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    14062 (F2r)
   04020 Calcium signaling pathway
    14062 (F2r)
   04072 Phospholipase D signaling pathway
    14062 (F2r)
   04024 cAMP signaling pathway
    14062 (F2r)
   04151 PI3K-Akt signaling pathway
    14062 (F2r)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14062 (F2r)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    14062 (F2r)
  Cell motility
   04810 Regulation of actin cytoskeleton
    14062 (F2r)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    14062 (F2r)
   04611 Platelet activation
    14062 (F2r)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14062 (F2r)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Complement peptide
   Thrombin
    14062 (F2r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
13 D1; 13 50.21 cM
AA seq 430 aa AA seqDB search
MGPRRLLIVALGLSLCGPLLSSRVPMSQPESERTDATVNPRSFFLRNPSENTFELVPLGD
EEEEEKNESVLLEGRAVYLNISLPPHTPPPPFISEDASGYLTSPWLTLFMPSVYTIVFIV
SLPLNVLAIAVFVLRMKVKKPAVVYMLHLAMADVLFVSVLPFKISYYFSGTDWQFGSGMC
RFATAAFYGNMYASIMLMTVISIDRFLAVVYPIQSLSWRTLGRANFTCVVIWVMAIMGVV
PLLLKEQTTRVPGLNITTCHDVLSENLMQGFYSYYFSAFSAIFFLVPLIVSTVCYTSIIR
CLSSSAVANRSKKSRALFLSAAVFCIFIVCFGPTNVLLIVHYLFLSDSPGTEAAYFAYLL
CVCVSSVSCCIDPLIYYYASSECQRHLYSILCCKESSDPNSCNSTGQLMPSKMDTCSSHL
NNSIYKKLLA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggggccccggcgcttgctgatcgtcgccctcggcctcagcctgtgcggtcccttgctg
tcttcccgcgtccctatgagccagccagaatcagagaggacagatgctacggtgaacccc
cgctcattctttctaaggaatcccagtgaaaatacatttgaactggtccccctgggggat
gaggaggaggaggagaaaaatgaaagcgtcctgctggagggtagggcagtctacttaaat
ataagcctccctcctcacacgccgcctcctcccttcatctccgaggacgcctccggatat
ctgaccagcccctggctgacgctcttcatgccctccgtgtacacgattgtgttcattgtc
agccttcctctgaacgtcctggccatcgcagtgttcgtcttgaggatgaaggtcaagaag
ccggccgtggtgtacatgctgcacctggccatggccgacgtgctcttcgtgtcggtgctc
cccttcaagatcagctactacttctccggcactgattggcagttcgggtctggaatgtgc
cgcttcgccaccgcagcgttttacgggaacatgtacgcctccatcatgctcatgacggtc
ataagcattgaccggttcctggcggtggtgtatccgatccagtccctgtcctggcgcact
ctgggccgagccaacttcacttgcgtggtcatttgggtgatggccatcatgggggtggtg
ccccttctcctcaaggagcagaccacccgagttccgggactcaacatcaccacctgccac
gacgtcctcagtgagaacctgatgcaaggcttttactcgtactacttctcggccttctcc
gccatcttctttcttgtgccgttgatcgtttccacggtctgctacacgtccatcatccgg
tgcctgagctcctccgcggttgccaaccggagcaagaagtcgcgggctttgttcctgtct
gccgcggtgttctgcatcttcatcgtctgctttgggcccaccaacgtcctcctgattgtg
cactaccttttcctctccgacagtcctggtacagaggcagcctactttgcttacctcctc
tgcgtctgtgtgagcagcgtgagctgctgcatcgatccgttgatttactactacgcctcc
tccgagtgccagaggcacctctacagcatcttgtgctgcaaagaaagctctgatcccaac
agttgcaacagcaccggccagctgatgccgagtaaaatggatacctgctctagtcacctg
aataacagcatatacaaaaagctattagcttag

DBGET integrated database retrieval system