KEGG   Mus musculus (mouse): 14065Help
Entry
14065             CDS       T01002                                 

Gene name
F2rl3, PAR4
Definition
(RefSeq) coagulation factor II (thrombin) receptor-like 3
  KO
K04236  
coagulation factor II (thrombin) receptor-like 3
Organism
mmu  Mus musculus (mouse)
Pathway
Rap1 signaling pathway
Neuroactive ligand-receptor interaction
Complement and coagulation cascades
Platelet activation
Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    14065 (F2rl3)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14065 (F2rl3)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    14065 (F2rl3)
   04611 Platelet activation
    14065 (F2rl3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14065 (F2rl3)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Complement peptide
   Thrombin
    14065 (F2rl3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 35.08 cM; 8 B3.3
AA seq 396 aa AA seqDB search
MCWPLLYPLVLGLSISLAEGIQTPSIYDDVESTRGSHEGPLGPTVELKEPKSSDKPNPRG
YPGKFCANDSDTLELPASSQALLLGWVPTRLVPALYGLVVAVGLPANGLALWVLATRVPR
LPSTILLMNLAVADLLLALVLPPRLAYHLRGQRWPFGEAACRVATAALYGHMYGSVLLLA
AVSLDRYLALVHPLRARALRGQRLTTGLCLVAWLSAATLALPLTLHRQTFRLAGSDRMLC
HDALPLTEQTSHWRPAFICLAVLGCFVPLLAMGLCYGATLRALAANGQRYSHALRLTALV
LFSAVASFTPSNVLLVLHYSNPSPEAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSHEFR
EKVRAMLCRQPEASSSSQASREAGSRGTAICSSTLL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggccgctgctgtatcctttggtgctggggctcagcatcagcctggcagagggc
atccagacccccagcatctacgatgatgtagagagtaccaggggaagccatgaaggccct
ctgggtcccacagtagaactcaaggagccgaagtcctcagacaagcctaatccacgaggc
tacccgggcaaattctgtgccaacgacagtgacacgctggagctcccggccagctctcaa
gcactgctgctggggtgggtccccacgaggctggtacctgccctctatgggcttgtggtg
gctgtggggctgcctgccaatgggctggcgctgtgggtgctggccacaagggtgccacgc
ctgccatccaccattctgctcatgaacctggcagtggctgatctgctgttggccctggtg
ctgccaccacgactggcttaccacttgcgtggccagcgctggccatttggtgaggctgcc
tgccgggtggccacagctgccctctatggccacatgtatggttcagtgttgctgctggct
gcagtcagcttggacagatacctggccctggtgcatcctttgcgggcccgtgcactgcgt
ggtcaacgcctcactactggactctgtttggtggcctggctctctgcagccaccctggcc
ttgcctctcactctgcatcggcagaccttccgattagctggctccgatcgcatgctgtgt
catgatgcgctgcccctgactgagcagacctcccactggagaccggccttcatctgcctg
gctgtcctgggctgcttcgtgccactgctggccatgggcctgtgctatggagccaccctt
cgtgcactggcggccaatggccagcgctacagccatgcactcagactgacagccctggta
ctgttctcggcagtggcctctttcacacctagcaatgtgctgctggtgctgcactattca
aacccgagccctgaggcctggggcaatctctatggagcctatgtgcccagcctggcactc
agcaccctcaacagctgcgtagaccctttcatctactactatgtgtcccatgagttcagg
gagaaggtacgcgctatgttgtgtcgccagccggaggccagcagctcctctcaggcctcc
agggaggctggaagccgagggactgccatttgctcctctacacttctgtga

DBGET integrated database retrieval system