KEGG   Mus musculus (mouse): 140723Help
Entry
140723            CDS       T01002                                 

Gene name
Cacng5
Definition
(RefSeq) calcium channel, voltage-dependent, gamma subunit 5
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04260  Cardiac muscle contraction
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04921  Oxytocin signaling pathway
mmu05410  Hypertrophic cardiomyopathy (HCM)
mmu05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
mmu05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    140723 (Cacng5)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    140723 (Cacng5)
  Circulatory system
   04260 Cardiac muscle contraction
    140723 (Cacng5)
   04261 Adrenergic signaling in cardiomyocytes
    140723 (Cacng5)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    140723 (Cacng5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    140723 (Cacng5)
   05414 Dilated cardiomyopathy (DCM)
    140723 (Cacng5)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN gamma
   140723 (Cacng5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc DUF716 DUF373 Claudin_3 DHHC
Motif
Other DBs
NCBI-GeneID: 140723
NCBI-ProteinID: NP_001186230
MGI: 2157946
Ensembl: ENSMUSG00000040373
Vega: OTTMUSG00000003104
UniProt: Q8VHW4 Q544Q4
Position
11; 11 E1
AA seq 275 aa AA seqDB search
MSACGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWIRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcctgtgggaggaaggccctgaccctgctgagcagcgtctttgccgtctgcggc
ctggggctgctgggtatcgcggtcagcacggactactggctctacctggaagaaggcata
atcctcccacagaaccagagcacagaggtcaagatgtccctgcactcgggcctctggcgg
gtctgcttcctcgctggtgaggagcgaggacgctgttttaccatagagtatgtgatgccc
atgaactcccagatgacgtcagaatccactgtcaatgttctaaaaatgattcgctcagcc
acgccgttccccctcgtcagcctcttcttcatgttcattgggtttatcctgagcaacatc
gggcacatccgtccgcaccggaccatactggcctttgtctccggcatcttctttatcctc
tctggcctctctcttgtggtgggcctggtgctgtacatctccagcatcaatgacgagatg
ctcaacagaaccaaggatgcagagacctatttcaactacaagtatggatggtcatttgcc
tttgctgccatctccttccttttaacagagagtgctggggtgatgtctgtgtacctgttc
atgaagaggtacactgctgaggacatgtacagacctcacccaggcttctaccggccacgt
ctgagcaactgctccgattactctggccagtttctacatccagatgcctggatccggggc
cgcagcccctcggacatctccagcgacgcctcgctacagatgaacagcaactacccagct
ttgctcaagtgcccagactatgaccagatgtcatcatctccctgctga

DBGET integrated database retrieval system