KEGG   Mus musculus (mouse): 14073Help
Entry
14073             CDS       T01002                                 

Gene name
Faah, AW412498
Definition
(RefSeq) fatty acid amide hydrolase (EC:3.5.1.99)
  KO
K15528  
fatty acid amide hydrolase [EC:3.5.1.99]
Organism
mmu  Mus musculus (mouse)
Pathway
Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    14073 (Faah)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.99  fatty acid amide hydrolase
     14073 (Faah)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 D1; 4 53.08 cM
AA seq 579 aa AA seqDB search
MVLSEVWTALSGLSGVCLACSLLSAAVVLRWTRSQTARGAVTRARQKQRAGLETMDKAVQ
RFRLQNPDLDSEALLALPLLQLVQKLQSGELSPEAVLFTYLGKAWEVNKGTNCVTSYLTD
CETQLSQAPRQGLLYGVPVSLKECFSYKGHASTLGLSLNEGVTSESDCVVVQVLKLQGAV
PFVHTNVPQSMLSYDCSNPLFGQTMNPWKPSKSPGGSSGGEGALIGSGGSPLGLGTDIGG
SIRFPSAFCGICGLKPTGNRLSKSGLKSCVYGQTAVQLSVGPMARDVDSLALCMKALLCE
DLFRLDSTIPPLPFREEIYRSSRPLRVGYYETDNYTMPTPAMRRAVMETKQSLEAAGHTL
VPFLPNNIPYALEVLSAGGLFSDGGCSFLQNFKGDFVDPCLGDLVLVLKLPRWFKKLLSF
LLKPLFPRLAAFLNSMCPRSAEKLWELQHEIEMYRQSVIAQWKAMNLDVVLTPMLGPALD
LNTPGRATGAISYTVLYNCLDFPAGVVPVTTVTAEDDAQMEHYKGYFGDMWDNILKKGMK
KGIGLPVAVQCVALPWQEELCLRFMREVERLMTPEKRPS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgagcgaagtgtggaccgcgctgtctggactctccggggtttgcctagcctgc
agcttgctgtcggcggcggtggtcctgcgatggaccaggagccagaccgcccggggcgcg
gtgaccagggcgcggcagaagcagcgagccggcctggagaccatggacaaggcggtgcag
cgcttccggctgcagaatcctgacctggattcagaggccttgctggctctgcccctgctc
caactggtacagaagttacagagtggggaactgtccccagaagctgtgctctttacctac
ctgggaaaggcctgggaagtgaacaaagggaccaactgtgtgacctcctatctgactgac
tgtgagactcagctgtcccaggccccacggcagggcctgctctatggcgtccccgtgagc
ctcaaggaatgcttcagctacaagggccatgcttccacactgggcttaagtttgaacgag
ggtgtgacatcggagagtgactgtgtggtggtgcaggtactgaagctgcagggagctgtg
ccctttgtgcacaccaacgtcccccagtccatgctaagctatgactgcagtaaccccctc
tttggccagaccatgaacccgtggaagccctccaagagtccaggaggttcctcagggggt
gagggggctctcattggatctggaggctcccctctgggtttaggcactgacatcggcggc
agcatccggttcccttctgccttctgtggcatctgtggcctcaagcctactgggaaccgc
ctcagcaagagtggcctgaagagctgtgtttatggacagacagcagtgcagctttctgtt
ggccccatggcacgggatgtggatagcctggcattgtgcatgaaagccctactttgtgag
gatttgttccgcttggactccaccatcccccccttgcccttcagggaggagatctacaga
agttctcgaccccttcgtgtgggatactatgaaactgacaactacaccatgcccactcca
gccatgaggagggctgtgatggagaccaagcagagtctcgaggctgctggccacacgctg
gtccccttcttaccaaacaacataccttatgccctggaggtcctgtcggcaggtgggctg
ttcagtgatggtggctgctcttttctccaaaacttcaaaggcgactttgtggatccctgc
ttgggggacctggtcttagtgctgaagctgcccaggtggtttaaaaaactgctgagcttc
ctgctgaagcctctgtttcctcggctggcagcctttctcaacagtatgtgtcctcggtca
gccgaaaagctgtgggaactgcagcatgagattgagatgtatcgccagtccgtcattgcc
cagtggaaggcaatgaacttggacgtggtgctaacccccatgctgggtcctgctctggat
ttgaacacaccgggcagagccacaggggctatcagctacactgttctctataactgcctg
gacttccctgcgggggtggtgcctgtcaccactgtgaccgctgaggacgatgcccagatg
gaacactacaaaggctactttggggatatgtgggacaacattctgaagaagggcatgaaa
aagggtataggcctgcctgtggctgtgcagtgcgtggctctgccctggcaggaagagctg
tgtctgcggttcatgcgggaggtggaacggctgatgacccctgaaaagcggccatcttga

DBGET integrated database retrieval system