KEGG   Mus musculus (mouse): 14077Help
Entry
14077             CDS       T01002                                 

Gene name
Fabp3, Fabph-1, Fabph-4, Fabph1, Fabph4, H-FABP, Mdgi
Definition
(RefSeq) fatty acid binding protein 3, muscle and heart
  KO
K08752  
fatty acid-binding protein 3, muscle and heart
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    14077 (Fabp3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   14077 (Fabp3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
4 D2.2; 4 63.43 cM
AA seq 133 aa AA seqDB search
MADAFVGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDTITIKTQSTFKN
TEINFQLGIEFDEVTADDRKVKSLVTLDGGKLIHVQKWNGQETTLTRELVDGKLILTLTH
GSVVSTRTYEKEA
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgcctttgtcggtacctggaagctagtggacagcaagaattttgatgactac
atgaagtcactcggtgtgggctttgccaccaggcaggtggctagcatgaccaagcctact
accatcatcgagaagaacggggatactatcaccataaagacacaaagtaccttcaagaac
acagagatcaactttcagctgggaatagagttcgacgaggtgacagcagatgaccggaag
gtcaagtcactggtgacgctggacggaggcaaactcatccatgtgcagaagtggaacggg
caggagacaacactaactagggagctagttgacgggaaactcatcctgactctcactcat
ggcagtgtggtgagcactcggacttatgagaaggaggcgtga

DBGET integrated database retrieval system