KEGG   Mus musculus (mouse): 14084Help
Entry
14084             CDS       T01002                                 

Gene name
Faf1, AA408698, Dffrx, Fam
Definition
(RefSeq) Fas-associated factor 1
  KO
K20703  
FAS-associated factor 1
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 C6; 4 51.33 cM
AA seq 649 aa AA seqDB search
MASNMDREMILADFQACTGIENIDEAITLLEQNNWDLVAAINGVIPQENGILQSDFGGET
MPGPTFDPASHPAPASTPSSSAFRPVMPSRQIVERQPRMLDFRVEYRDRNVDVVLEDSCT
VGEIKQILENELQIPVPKMLLKGWKTGDVEDSTVLKSLHLPKNNSLYVLTPDLPPPSSSS
HAGALQESLNQNFMLIITHREVQREYNLNFSGSSTVQEVKRNVYDLTSIPVRHQLWEGWP
ASATDDSMCLAESGLSYPCHRLTVGRRTSPVQTREQSEEQSTDVHMVSDSDGDDFEDASE
FGVDDGEVFGMASSTLRKSPMMPENAENEGDALLQFTAEFSSRYGDCHPVFFIGSLEAAF
QEAFYVKARDRKLLAIYLHHDESVLTNVFCSQMLCAESIVSYLSQNFITWAWDLTKDTNR
ARFLTMCNRHFGSVIAQTIRTQKTDQFPLFLIIMGKRSSNEVLNVIQGNTTVDELMMRLM
AAMEIFSAQQQEDIKDEDEREARENVKREQDEAYRLSLEADRAKREAHEREMAEQFRLEQ
IRKEQEEEREAIRLSLEQALPPEPKEENAEPVSKLRIRTPSGEFLERRFLASNKLQIVFD
FVASKGFPWDEFKLLSTFPRRDVTQLDPNKSLLEVNLFPQETLFLQAKE
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccaacatggaccgggagatgatccttgcggattttcaggcatgtactggtatt
gaaaacatcgatgaagctattacactgcttgagcaaaataactgggacttggtggcagct
attaatggtgtaataccacaggaaaatggcattctacaaagtgactttggaggtgagacc
atgccaggacccacatttgatccagcaagtcaccctgctccagcttcaactccctcttct
tcagcgtttcgacctgtaatgccatccaggcagattgtagaaaggcagcctcgaatgcta
gacttcagagttgaatacagagacagaaatgttgatgtggtacttgaagacagctgtact
gttggagagatcaaacagattctagaaaatgagcttcagatacctgtgcctaaaatgctg
ttaaaaggctggaagactggagacgtggaagacagtacggtcttaaaatcactacacttg
ccaaaaaacaacagtctttatgtccttacaccagacttgccaccgccttcatcatccagc
catgctggtgccctgcaggaatcattaaatcaaaacttcatgctgatcatcacccaccga
gaggtccagcgggagtacaacctgaacttctcaggaagcagtaccgttcaagaggtaaag
agaaatgtgtatgaccttacaagcatacctgttcgacatcagttatgggagggctggcca
gcttctgccaccgatgactcaatgtgtcttgctgaatcaggcctctcttatccctgccat
cgattaactgtgggaagaagaacttcacctgtacagacccgtgagcaatcagaagagcaa
agcacggatgttcatatggttagtgatagtgatggcgatgactttgaagatgcttcagaa
tttggagtggatgacggagaagtatttggcatggcatcatctaccctgagaaaatctcca
atgatgccagaaaacgcagaaaatgaaggagatgccttattacaatttacagcagagttt
tcttcaagatatggtgactgccatcctgtattttttattggctcattagaagctgctttc
caagaggccttctatgtgaaagcccgagacagaaaacttcttgctatctacctccaccat
gatgaaagtgtactaaccaacgtgttctgctcacaaatgctttgtgctgaatccattgtt
tcctatctgagtcaaaattttataacctgggcttgggatctgacaaaggacaccaacaga
gcaagatttctgacaatgtgcaatagacactttggcagcgttattgcacaaactattcgg
actcaaaagacagatcagtttccacttttcctgattatcatgggaaagcgatcatctaat
gaagtgttaaatgtgatacaaggtaatacaacagtggatgagttaatgatgagactcatg
gctgcaatggagattttctcagctcaacaacaggaagacattaaggatgaggatgaacgt
gaagccagagaaaatgtgaagagagagcaagatgaggcctatcgcctttccctcgaagcc
gacagggcaaagagagaagctcatgagagagagatggcagaacagtttcgtttggagcag
attcgcaaagaacaagaagaagaacgtgaggccatcagactctccttagaacaagccctt
cctccagagccgaaggaagaaaatgctgagcctgttagcaagcttcggattcgaaccccc
agtggcgagttcctggaacggcgtttcctggccagcaataagctccagattgtctttgat
ttcgtggcttccaagggatttccatgggatgaattcaagttactgagcacctttcctagg
agagatgtaactcagctagaccccaataagtcattattggaggtaaacttgttccctcaa
gaaacccttttccttcaagcaaaagagtaa

DBGET integrated database retrieval system