KEGG   Mus musculus (mouse): 140859Help
Entry
140859            CDS       T01002                                 

Gene name
Nek8, 4632401F23Rik, b2b1449Clo, jck
Definition
(RefSeq) NIMA (never in mitosis gene a)-related expressed kinase 8 (EC:2.7.11.1)
  KO
K08857  
NIMA (never in mitosis gene a)-related kinase [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     140859 (Nek8)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  NEK family
   140859 (Nek8)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     140859 (Nek8)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    140859 (Nek8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 B5; 11 46.74 cM
AA seq 698 aa AA seqDB search
MEKYERIRVVGRGAFGIVHLCLRKADQKLVILKQIPVEQMTKEERQAAQNECQVLKLLNH
PNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVH
THLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLS
LEPAQRPPLSHIMAQPLCIRALLNIHTDVGSVRMRRAEKSLTPGPPIASGSTGSRATSAR
CRGVPRGPVRPAIPPPLSSVYAWGGGLSSPLRLPMLNTEVVQVAAGRTQKAGVTRSGRLI
LWEAPPLGAGGGTLLPGAVELPQPQFVSRFLEGQSGVTIKHVACGDLFTACLTDRGIIMT
FGSGSNGCLGHGNLTDISQPTIVEALLGYEMVQVACGASHVLALSTDGELFAWGRGDGGR
LGLGTRESHNCPQQVPVAPGQEAQRVVCGIDSSMILTSPGRVLACGSNRFNKLGLDHLSL
DEEPVPYQQVEEALSFTPLGSAPLDQEPLLCVDLGTAHSAAITASGDCYTFGSNQHGQLG
TSSRRVSRAPCRVQGLEGIKMVMVACGDAFTVAVGAEGEVYSWGKGTRGRLGRRDEDAGL
PRPVQLDETHPYMVTSVSCCHGNTLLAVRSVTDEPVPP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtacgagcggatccgagtggtgggaagaggtgccttcgggattgtgcacctg
tgcctgcgaaaggccgaccagaagctggtgatcctcaagcagatcccagtggaacagatg
accaaagaagagaggcaggcggcccagaacgagtgccaggtgctcaagctgctcaaccac
cccaacgtcatcgagtactatgagaatttcctagaggacaaggccctcatgattgctatg
gagtacgcaccaggtggcaccttggccgagttcatccagaagcgctgcaactctctgcta
gaggaggagacgatccttcacttctttgtgcagatcctgctggctctgcatcacgtgcac
acacatctcatcctgcatcgggacctcaagacacagaacatccttcttgacaaacaccgc
atggtggtcaagatcggtgactttggcatctctaagatcctcagcagcaagagcaaggcc
tacacggtggtgggtacaccctgctacatctcccctgagctgtgtgagggcaaaccctac
aaccagaagagtgacatctgggctctgggctgtgtcttatatgagctggccagcctcaag
agggccttcgaggctgcaaacttgccagccctggtgctgaagatcatgagtggcaccttc
gcacccatctctgaccggtacagccctgagcttcgccagctcgtcctgagtctgcttagc
ctggaacctgcacagaggccacccctcagccacatcatggcgcagcccctctgcatccgg
gccctactcaacatccacaccgatgtgggcagcgtgcgcatgcggagggcagagaagtcc
ctgaccccaggaccacctatagcctctggcagcacagggagcagggccaccagtgcccga
tgtaggggtgtcccccggggacctgtgagaccggctatcccaccgccactgtcttcggtc
tacgcttggggtggtggccttagcagtcccctgaggttgccaatgctcaacacggaggtg
gtccaggtagccgctgggcgcacgcagaaggctggcgttacgcgctctggacgcctcatc
ctgtgggaggccccacccctgggagctggaggcggcacactccttcctggagccgtggag
ctgcctcagccccagtttgtctctcgtttcctggaaggccagtcaggtgtgaccatcaag
catgtggcctgcggggacctgttcaccgcttgcttgacagaccgaggcattatcatgacg
ttcggcagtggcagcaatgggtgtttaggtcacggcaacctgactgacatcagccagccc
accattgtagaagccttgctgggctatgagatggtgcaggtggcctgtggggcctctcat
gtgctggccctgtccacagatggagagttattcgcctggggcagaggagatggtggtaga
ctgggactaggcaccagggagtcccataactgccctcagcaggtgcctgtggccccagga
caggaagctcagagagttgtctgtggtattgactcttccatgatcctcacctctccaggc
agggtcctggcctgtggaagtaacaggttcaacaagctaggcttggaccacctatccctg
gacgaggagcctgttccctaccagcaagtggaggaggccctgagcttcacaccactgggc
tctgcacctctggaccaggagcccctgctgtgtgtggaccttggcactgctcattcagct
gctatcactgcttctggggactgctatacttttggcagcaatcaacatggacagctgggc
accagttcccgcagggtcagcagggcaccctgtcgggtccaaggcctggagggcatcaag
atggtgatggtggcctgcggggatgccttcactgtggccgttggggcagagggggaagtg
tattcttggggcaaaggaacccgaggccgactgggaaggagggatgaggatgcggggctg
cctaggccagtgcagctggatgagactcatccttacatggtgacttcagtgtcctgctgc
catgggaacactctgctggctgttcgatcagtcacagatgaaccagttcccccctga

DBGET integrated database retrieval system