KEGG   Mus musculus (mouse): 14086Help
Entry
14086             CDS       T01002                                 

Gene name
Fscn1, AI663989, Fan1, fascin-1
Definition
(RefSeq) fascin actin-bundling protein 1
  KO
K17455  
fascin 1/2
Organism
mmu  Mus musculus (mouse)
Brite
Membrane trafficking [BR:mmu04131]
 Protein recycling
  Rab GTPases and associated proteins
   Others
    14086 (Fscn1)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     14086 (Fscn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 81.84 cM
AA seq 493 aa AA seqDB search
MTANGTAEAVQIQFGLISCGNKYLTAEAFGFKVNASASSLKKKQIWTLEQPPDEAGSAAV
CLRSHLGRYLAADKDGNVTCEREVPDGDCRFLVVAHDDGRWSLQSEAHRRYFGGTEDRLS
CFAQSVSPAEKWSVHIAMHPQVNIYSVTRKRYAHLSARPADEIAVDRDVPWGVDSLITLA
FQDQRYSVQTSDHRFLRHDGRLVARPEPATGFTLEFRSGKVAFRDCEGRYLAPSGPSGTL
KAGKATKVGKDELFALEQSCAQVVLQAANERNVSTRQGMDLSANQDEETDQETFQLEIDR
DTRKCAFRTHTGKYWTLTATGGVQSTASTKNASCYFDIEWCDRRITLRASNGKFVTAKKN
GQLAASVETAGDSELFLMKLINRPIIVFRGEHGFIGCRKVTGTLDANRSSYDVFQLEFND
GAYNIKDSTGKYWTVGSDSSVTSSSDTPVDFFLEFCDYNKVALKVGGRYLKGDHAGVLKA
CAETIDPASLWEY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaacggcacggcagaggctgtgcagattcagttcgggctcatcagctgcggc
aacaagtacctgacagccgaggcgttcgggttcaaggtgaacgcatccgctagtagcttg
aaaaagaagcagatctggacgctggagcaacctcccgatgaggcgggcagcgcggccgtg
tgtctgcgcagccacctgggtcgctacctggccgccgacaaggacggcaacgtgacctgc
gagcgcgaggtgcccgacggcgactgccgctttctcgtcgtggcgcacgacgacggccgc
tggtcgctgcagtccgaggctcaccggcgctactttggcggcaccgaggaccgcctgtcc
tgcttcgcgcagagcgtgtcgccggccgagaagtggagcgtgcacatcgccatgcacccg
caggttaacatctacagcgttacccgcaagcgctacgcgcatctgagcgcgcggccggcc
gacgagatcgcggtagaccgcgacgtgccttggggcgtcgactcgctcatcaccttggcc
ttccaggaccaacgctacagtgtgcagacgtccgaccaccgcttcctgcgccacgacggg
cgccttgtggcacggccggagcccgccacgggcttcacgctggagttccgctccggcaag
gtggcctttcgcgactgcgaaggtcgctacctggctccgtccgggcccagcggcaccctc
aaggctggcaaggccaccaaggtgggcaaagatgagctcttcgccctggaacagagctgc
gctcaggtggtgctgcaggcggccaacgagaggaacgtgtccacgcgccagggaatggac
ctgtcagccaatcaggatgaagagaccgatcaggagaccttccagctggagatcgaccgc
gacacaagaaagtgtgcctttcgcacccacacgggcaagtactggacactgacggcgacc
ggaggtgtgcaatccactgcgtccaccaagaacgccagctgctactttgacatcgagtgg
tgtgaccgccggatcactctgagagcctccaacggcaagtttgtgaccgccaagaaaaat
ggccagctggccgcctcggtggagacagcaggggactcggaactcttcctcatgaagctg
attaaccgccccatcatcgtgttccggggggaacacgggttcattggctgccgcaaggtc
acgggcactctggatgccaaccgttccagttacgatgtcttccagttggaattcaatgac
ggcgcctacaacatcaaagactccacgggcaagtactggacggtgggtagtgattcctcg
gtcaccagcagcagcgacacccctgtggatttcttccttgagttctgtgactacaataag
gtggctctcaaggtgggcggccgctacctgaagggggaccacgctggggtcctgaaggcc
tgcgcggagactatcgaccccgcctcactctgggagtactag

DBGET integrated database retrieval system