KEGG   Mus musculus (mouse): 14102Help
Entry
14102             CDS       T01002                                 

Gene name
Fas, AI196731, APO1, APT1, CD95, TNFR6, Tnfrsf6, lpr
Definition
(RefSeq) Fas (TNF receptor superfamily member 6)
  KO
K04390  
tumor necrosis factor receptor superfamily member 6
Organism
mmu  Mus musculus (mouse)
Pathway
Platinum drug resistance
MAPK signaling pathway
Cytokine-cytokine receptor interaction
p53 signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
TNF signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Alzheimer's disease
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Pathways in cancer
Proteoglycans in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    14102 (Fas)
   04668 TNF signaling pathway
    14102 (Fas)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14102 (Fas)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    14102 (Fas)
   04115 p53 signaling pathway
    14102 (Fas)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    14102 (Fas)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14102 (Fas)
   05205 Proteoglycans in cancer
    14102 (Fas)
  Immune diseases
   05320 Autoimmune thyroid disease
    14102 (Fas)
   05330 Allograft rejection
    14102 (Fas)
   05332 Graft-versus-host disease
    14102 (Fas)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    14102 (Fas)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    14102 (Fas)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    14102 (Fas)
  Infectious diseases
   05162 Measles
    14102 (Fas)
   05164 Influenza A
    14102 (Fas)
   05161 Hepatitis B
    14102 (Fas)
   05168 Herpes simplex infection
    14102 (Fas)
   05142 Chagas disease (American trypanosomiasis)
    14102 (Fas)
   05143 African trypanosomiasis
    14102 (Fas)
  Antineoplastic resistance
   01524 Platinum drug resistance
    14102 (Fas)
Cytokine receptors [BR:mmu04050]
 TNF receptor family
  14102 (Fas)
Cellular antigens [BR:mmu04090]
 Proteins
  14102 (Fas)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19 C1; 19 29.48 cM
AA seq 327 aa AA seqDB search
MLWIWAVLPLVLAGSQLRVHTQGTNSISESLKLRRRVRETDKNCSEGLYQGGPFCCQPCQ
PGKKKVEDCKMNGGTPTCAPCTEGKEYMDKNHYADKCRRCTLCDEEHGLEVETNCTLTQN
TKCKCKPDFYCDSPGCEHCVRCASCEHGTLEPCTATSNTNCRKQSPRNRLWLLTILVLLI
PLVFIYRKYRKRKCWKRRQDDPESRTSSRETIPMNASNLSLSKYIPRIAEDMTIQEAKKF
ARENNIKEGKIDEIMHDSIQDTAEQKVQLLLCWYQSHGKSDAYQDLIKGLKKAECRRTLD
KFQDMVQKDLGKSTPDTGNENEGQCLE
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgctgtggatctgggctgtcctgcctctggtgcttgctggctcacagttaagagttcat
actcaaggtactaatagcatctccgagagtttaaagctgaggaggcgggttcgtgaaact
gataaaaactgctcagaaggattatatcaaggaggcccattttgctgtcaaccatgccaa
cctggtaaaaaaaaagttgaggactgcaaaatgaatgggggtacaccaacctgcgcccca
tgcacagaagggaaggagtacatggacaagaaccattatgctgataaatgcagaagatgc
acactctgcgatgaagagcatggtttagaggtggaaacaaactgcaccctgacccagaat
accaagtgcaagtgcaaaccagacttctactgcgattctcctggctgtgaacactgtgtt
cgctgcgcctcgtgtgaacatggaacccttgagccgtgcacagcaaccagcaatacaaac
tgcaggaaacaaagtcccagaaatcgcctatggttgttgaccatccttgttttgttaatt
ccacttgtatttatatatcgaaagtaccggaaaagaaagtgctggaaaaggagacaggat
gaccctgaatctagaacctccagtcgtgaaaccataccaatgaatgcctcaaatcttagc
ttgagtaaatacatcccgagaattgctgaagacatgacaatccaggaagctaaaaaattt
gctcgagaaaataacatcaaggagggcaagatagatgagatcatgcatgacagcatccaa
gacacagctgagcagaaagtccagctgctcctgtgctggtaccaatctcatgggaagagt
gatgcatatcaagatttaatcaagggtctcaaaaaagccgaatgtcgcagaaccttagat
aaatttcaggacatggtccagaaggaccttggaaaatcaaccccagacactggaaatgaa
aatgaaggacaatgtctggagtga

DBGET integrated database retrieval system