KEGG   Mus musculus (mouse): 14103Help
Entry
14103             CDS       T01002                                 

Gene name
Fasl, APT1LG1, CD178, CD95-L, CD95L, Fas-L, Faslg, Tnfsf6, Tnlg1a, gld
Definition
(RefSeq) Fas ligand (TNF superfamily, member 6)
  KO
K04389  
tumor necrosis factor ligand superfamily member 6
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Cytokine-cytokine receptor interaction
FoxO signaling pathway
PI3K-Akt signaling pathway
Apoptosis
Natural killer cell mediated cytotoxicity
Neurotrophin signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Type I diabetes mellitus
Chagas disease (American trypanosomiasis)
African trypanosomiasis
Hepatitis B
Measles
Influenza A
Herpes simplex infection
Pathways in cancer
Proteoglycans in cancer
Autoimmune thyroid disease
Allograft rejection
Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14103 (Fasl)
   04010 MAPK signaling pathway
    14103 (Fasl)
   04068 FoxO signaling pathway
    14103 (Fasl)
   04151 PI3K-Akt signaling pathway
    14103 (Fasl)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14103 (Fasl)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    14103 (Fasl)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    14103 (Fasl)
  Nervous system
   04722 Neurotrophin signaling pathway
    14103 (Fasl)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14103 (Fasl)
   05205 Proteoglycans in cancer
    14103 (Fasl)
  Immune diseases
   05320 Autoimmune thyroid disease
    14103 (Fasl)
   05330 Allograft rejection
    14103 (Fasl)
   05332 Graft-versus-host disease
    14103 (Fasl)
  Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    14103 (Fasl)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    14103 (Fasl)
  Infectious diseases
   05162 Measles
    14103 (Fasl)
   05164 Influenza A
    14103 (Fasl)
   05161 Hepatitis B
    14103 (Fasl)
   05168 Herpes simplex infection
    14103 (Fasl)
   05142 Chagas disease (American trypanosomiasis)
    14103 (Fasl)
   05143 African trypanosomiasis
    14103 (Fasl)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   14103 (Fasl)
Cytokines [BR:mmu04052]
 TNF family
  14103 (Fasl)
Cellular antigens [BR:mmu04090]
 Proteins
  14103 (Fasl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H2.1; 1 69.95 cM
AA seq 279 aa AA seqDB search
MQQPMNYPCPQIFWVDSSATSSWAPPGSVFPCPSCGPRGPDQRRPPPPPPPVSPLPPPSQ
PLPLPPLTPLKKKDHNTNLWLPVVFFMVLVALVGMGLGMYQLFHLQKELAELREFTNQSL
KVSSFEKQIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLV
INETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHS
SYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgcagcagcccatgaattacccatgtccccagatcttctgggtagacagcagtgccact
tcatcttgggctcctccagggtcagtttttccctgtccatcttgtgggcctagagggccg
gaccaaaggagaccgccacctccaccaccacctgtgtcaccactaccaccgccatcacaa
ccactcccactgccgccactgacccctctaaagaagaaggaccacaacacaaatctgtgg
ctaccggtggtatttttcatggttctggtggctctggttggaatgggattaggaatgtat
cagctcttccacctgcagaaggaactggcagaactccgtgagttcaccaaccaaagcctt
aaagtatcatcttttgaaaagcaaatagccaaccccagtacaccctctgaaaaaaaagag
ccgaggagtgtggcccatttaacagggaacccccactcaaggtccatccctctggaatgg
gaagacacatatggaaccgctctgatctctggagtgaagtataagaaaggtggccttgtg
atcaacgaaactgggttgtacttcgtgtattccaaagtatacttccggggtcagtcttgc
aacaaccagcccctaaaccacaaggtctatatgaggaactctaagtatcctgaggatctg
gtgctaatggaggagaagaggttgaactactgcactactggacagatatgggcccacagc
agctacctgggggcagtattcaatcttaccagtgctgaccatttatatgtcaacatatct
caactctctctgatcaattttgaggaatctaagacctttttcggcttgtataagctttaa

DBGET integrated database retrieval system