KEGG   Mus musculus (mouse): 14127Help
Entry
14127             CDS       T01002                                 

Gene name
Fcer1g, AI573376, CD23, FcR-gamma, FcR[g], FcRgamma, Fce1g, FcepsilonRI, Ly-50
Definition
(RefSeq) Fc receptor, IgE, high affinity I, gamma polypeptide
  KO
K07983  
Fc receptor, IgE, high affinity I, gamma polypeptide
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Platelet activation
Natural killer cell mediated cytotoxicity
Fc epsilon RI signaling pathway
Tuberculosis
Asthma
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    14127 (Fcer1g)
   04071 Sphingolipid signaling pathway
    14127 (Fcer1g)
 Organismal Systems
  Immune system
   04611 Platelet activation
    14127 (Fcer1g)
   04650 Natural killer cell mediated cytotoxicity
    14127 (Fcer1g)
   04664 Fc epsilon RI signaling pathway
    14127 (Fcer1g)
 Human Diseases
  Immune diseases
   05310 Asthma
    14127 (Fcer1g)
  Infectious diseases
   05152 Tuberculosis
    14127 (Fcer1g)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   14127 (Fcer1g)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H3; 1 79.23 cM
AA seq 86 aa AA seqDB search
MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREK
ADAVYTGLNTRSQETYETLKHEKPPQ
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atgatctcagccgtgatcttgttcttgctccttttggtggaacaagcagccgccctggga
gagccgcagctctgctatatcctggatgctgtcctgtttttgtatggtattgtccttacc
ctactctactgtcgactcaagatccaggtccgaaaggcagctatagccagccgtgagaaa
gcagatgctgtctacacgggcctgaacacccggagccaggagacatatgagactctgaag
catgagaaaccaccccagtag

DBGET integrated database retrieval system