KEGG   Mus musculus (mouse): 14129Help
Entry
14129             CDS       T01002                                 

Gene name
Fcgr1, AI323638, AV092959, CD64, FcgammaRI, IGGHAFC
Definition
Fc receptor, IgG, high affinity I
Orthology
K06498  
high affinity immunoglobulin gamma Fc receptor I
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Osteoclast differentiation
Hematopoietic cell lineage
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    14129 (Fcgr1)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    14129 (Fcgr1)
   04666 Fc gamma R-mediated phagocytosis
    14129 (Fcgr1)
  Development
   04380 Osteoclast differentiation
    14129 (Fcgr1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    14129 (Fcgr1)
  Immune diseases
   05322 Systemic lupus erythematosus
    14129 (Fcgr1)
  Infectious diseases
   05150 Staphylococcus aureus infection
    14129 (Fcgr1)
   05152 Tuberculosis
    14129 (Fcgr1)
   05140 Leishmaniasis
    14129 (Fcgr1)
Cellular antigens [BR:mmu04090]
 Proteins
  14129 (Fcgr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3 F2.1; 3 41.72 cM
AA seq 404 aa AA seqDB search
MILTSFGDDMWLLTTLLLWVPVGGEVVNATKAVITLQPPWVSIFQKENVTLWCEGPHLPG
DSSTQWFINGTAVQISTPSYSIPEASFQDSGEYRCQIGSSMPSDPVQLQIHNDWLLLQAS
RRVLTEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSDSEVAILKTNLSHSGIYHCSGT
GRHRYTSAGVSITVKELFTTPVLRASVSSPFPEGSLVTLNCETNLLLQRPGLQLHFSFYV
GSKILEYRNTSSEYHIARAEREDAGFYWCEVATEDSSVLKRSPELELQVLGPQSSAPVWF
HILFYLSVGIMFSLNTVLYVKIHRLQREKKYNLEVPLVSEQGKKANSFQQVRSDGVYEEV
TATASQTTPKEAPDGPRSSVGDCGPEQPEPLPPSDSTGAQTSQS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcttaccagctttggagatgacatgtggcttctaacaactctgctactttgggtt
ccagtcggtggggaagtggttaatgccaccaaggctgtgatcaccttgcagcctccatgg
gtcagtattttccagaaggaaaatgtcactttatggtgtgaggggcctcacctgcctgga
gacagttccacacaatggtttatcaacggaacagccgttcagatctccacgcctagttat
agcatcccagaggccagttttcaggacagtggcgaatacaggtgtcagataggttcctca
atgccaagtgaccctgtgcagttgcaaatccacaatgattggctgctactccaggcctcc
cgcagagtcctcacagaaggagaacccctggccttgaggtgtcacggatggaagaataaa
ctggtgtacaatgtggttttctatagaaatggaaaatcctttcagttttcttcagattcg
gaggtcgccattctgaaaaccaacctgagtcacagcggcatctaccactgctcaggcacg
ggaagacaccgctacacatctgcaggagtgtccatcacggtgaaagagctgtttaccacg
ccagtgctgagagcatccgtgtcatctcccttcccggaggggagtctggtcaccctgaac
tgtgagacgaatttgctcctgcagagacccggcttacagcttcacttctccttctacgtg
ggcagcaagatcctggagtacaggaacacatcctcagagtaccatatagcaagggcggaa
agagaagatgctggattctactggtgtgaggtagccacggaggacagcagtgtccttaag
cgcagccctgagttggagctccaagtgcttggtccccagtcatcagctcctgtctggttt
cacatcctgttttatctgtcagtgggaataatgttttcgttgaacacggttctctatgtg
aaaatacacaggctgcagagagagaagaaatacaacttagaagtccctttggtttctgag
cagggaaagaaagcaaattcctttcagcaagttagaagcgatggcgtgtatgaagaagta
acagccactgcgagccagaccacaccaaaagaagcgcccgatggacctcgaagctcagtg
ggtgactgtggacccgagcagcctgaaccccttcctcccagtgacagtactggggcacaa
acttcccaaagttga

  All links  
No link information was found.   
DBGET integrated database retrieval system