KEGG   Mus musculus (mouse): 14129Help
Entry
14129             CDS       T01002                                 

Gene name
Fcgr1, AI323638, AV092959, CD64, FcgammaRI, IGGHAFC
Definition
Fc receptor, IgG, high affinity I
Orthology
K06498  
high affinity immunoglobulin gamma Fc receptor I
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Osteoclast differentiation
Hematopoietic cell lineage
Fc gamma R-mediated phagocytosis
Leishmaniasis
Staphylococcus aureus infection
Tuberculosis
Transcriptional misregulation in cancer
Systemic lupus erythematosus
Class
Cellular Processes; Transport and catabolism; Phagosome [PATH:mmu04145]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:mmu04640]
Organismal Systems; Immune system; Fc gamma R-mediated phagocytosis [PATH:mmu04666]
Organismal Systems; Development; Osteoclast differentiation [PATH:mmu04380]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mmu05202]
Human Diseases; Immune diseases; Systemic lupus erythematosus [PATH:mmu05322]
Human Diseases; Infectious diseases; Staphylococcus aureus infection [PATH:mmu05150]
Human Diseases; Infectious diseases; Tuberculosis [PATH:mmu05152]
Human Diseases; Infectious diseases; Leishmaniasis [PATH:mmu05140]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3 F2.1; 3 41.72 cM
AA seq 404 aa AA seqDB search
MILTSFGDDMWLLTTLLLWVPVGGEVVNATKAVITLQPPWVSIFQKENVTLWCEGPHLPG
DSSTQWFINGTAVQISTPSYSIPEASFQDSGEYRCQIGSSMPSDPVQLQIHNDWLLLQAS
RRVLTEGEPLALRCHGWKNKLVYNVVFYRNGKSFQFSSDSEVAILKTNLSHSGIYHCSGT
GRHRYTSAGVSITVKELFTTPVLRASVSSPFPEGSLVTLNCETNLLLQRPGLQLHFSFYV
GSKILEYRNTSSEYHIARAEREDAGFYWCEVATEDSSVLKRSPELELQVLGPQSSAPVWF
HILFYLSVGIMFSLNTVLYVKIHRLQREKKYNLEVPLVSEQGKKANSFQQVRSDGVYEEV
TATASQTTPKEAPDGPRSSVGDCGPEQPEPLPPSDSTGAQTSQS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcttaccagctttggagatgacatgtggcttctaacaactctgctactttgggtt
ccagtcggtggggaagtggttaatgccaccaaggctgtgatcaccttgcagcctccatgg
gtcagtattttccagaaggaaaatgtcactttatggtgtgaggggcctcacctgcctgga
gacagttccacacaatggtttatcaacggaacagccgttcagatctccacgcctagttat
agcatcccagaggccagttttcaggacagtggcgaatacaggtgtcagataggttcctca
atgccaagtgaccctgtgcagttgcaaatccacaatgattggctgctactccaggcctcc
cgcagagtcctcacagaaggagaacccctggccttgaggtgtcacggatggaagaataaa
ctggtgtacaatgtggttttctatagaaatggaaaatcctttcagttttcttcagattcg
gaggtcgccattctgaaaaccaacctgagtcacagcggcatctaccactgctcaggcacg
ggaagacaccgctacacatctgcaggagtgtccatcacggtgaaagagctgtttaccacg
ccagtgctgagagcatccgtgtcatctcccttcccggaggggagtctggtcaccctgaac
tgtgagacgaatttgctcctgcagagacccggcttacagcttcacttctccttctacgtg
ggcagcaagatcctggagtacaggaacacatcctcagagtaccatatagcaagggcggaa
agagaagatgctggattctactggtgtgaggtagccacggaggacagcagtgtccttaag
cgcagccctgagttggagctccaagtgcttggtccccagtcatcagctcctgtctggttt
cacatcctgttttatctgtcagtgggaataatgttttcgttgaacacggttctctatgtg
aaaatacacaggctgcagagagagaagaaatacaacttagaagtccctttggtttctgag
cagggaaagaaagcaaattcctttcagcaagttagaagcgatggcgtgtatgaagaagta
acagccactgcgagccagaccacaccaaaagaagcgcccgatggacctcgaagctcagtg
ggtgactgtggacccgagcagcctgaaccccttcctcccagtgacagtactggggcacaa
acttcccaaagttga

DBGET integrated database retrieval system