KEGG   Mus musculus (mouse): 14130Help
Entry
14130             CDS       T01002                                 

Gene name
Fcgr2b, AI528646, CD32, F630109E10Rik, Fc[g]RII, FcgRII, Fcgr2, Fcgr2a, Fcr-2, Fcr-3, Ly-17, Ly-m20, LyM-1, fcRII
Definition
(RefSeq) Fc receptor, IgG, low affinity IIb
  KO
K12560  
low affinity immunoglobulin gamma Fc region receptor II-b
Organism
mmu  Mus musculus (mouse)
Pathway
Phagosome
Osteoclast differentiation
B cell receptor signaling pathway
Fc gamma R-mediated phagocytosis
Staphylococcus aureus infection
Tuberculosis
Measles
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    14130 (Fcgr2b)
 Organismal Systems
  Immune system
   04662 B cell receptor signaling pathway
    14130 (Fcgr2b)
   04666 Fc gamma R-mediated phagocytosis
    14130 (Fcgr2b)
  Development
   04380 Osteoclast differentiation
    14130 (Fcgr2b)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    14130 (Fcgr2b)
   05152 Tuberculosis
    14130 (Fcgr2b)
   05162 Measles
    14130 (Fcgr2b)
Cellular antigens [BR:mmu04090]
 Proteins
  14130 (Fcgr2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H3; 1 78.02 cM
AA seq 293 aa AA seqDB search
MGILPFLLIPMESNWTVHVFSRTLCHMLLWTAVLNLAAGTHDLPKAVVKLEPPWIQVLKE
DTVTLTCEGTHNPGNSSTQWFHNGRSIRSQVQASYTFKATVNDSGEYRCQMEQTRLSDPV
DLGVISDWLLLQTPQLVFLEGETITLRCHSWRNKLLNRISFFHNEKSVRYHHYSSNFSIP
KANHSHSGDYYCKGSLGRTLHQSKPVTITVQGPKSSRSLPVLTIVAAVTGIAVAAIVIIL
VSLVYLKKKQVPDNPPDLEEAAKTEAENTITYSLLKHPEALDEETEHDYQNHI
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgccgttcctactgatccccatggagagcaactggactgtccatgtgttc
tcacggactttgtgccatatgctactgtggacagccgtgctaaatcttgctgctgggact
catgatcttccaaaggctgtggtcaaactcgagcccccgtggatccaggtgctcaaggaa
gacacggtgacactgacatgcgaagggacccacaaccctgggaactcttctacccagtgg
ttccacaatgggaggtccatccggagccaggtccaagccagctacacgtttaaggccaca
gtcaatgacagtggagaatatcggtgtcaaatggagcagacccgcctcagcgaccctgta
gatctgggagtgatttctgactggctgctgctccagacccctcagctggtgtttctggaa
ggggaaaccatcacgctaaggtgccatagctggaggaacaaactactgaacaggatctcg
ttcttccataatgaaaaatccgtgaggtatcatcactacagtagtaatttctctatccca
aaagccaaccacagtcacagtggggactactactgcaaaggaagtctaggaaggacactg
caccagtccaagcctgtcaccatcactgtccaagggcccaagtccagcaggtctttacca
gtattgacaattgtggctgctgtcactgggattgctgtcgcagccattgttattatccta
gtatccttggtctatctcaagaaaaagcaggttccagacaatcctcctgatctggaagaa
gctgccaaaactgaggctgagaatacgatcacctactcacttctcaagcatcccgaagcc
ctggatgaagaaacagagcatgattaccagaaccacatttag

DBGET integrated database retrieval system