KEGG   Mus musculus (mouse): 14133Help
Entry
14133             CDS       T01002                                 

Gene name
Fcna, Fcn1
Definition
(RefSeq) ficolin A
  KO
K10104  
ficolin
Organism
mmu  Mus musculus (mouse)
Brite
Cell adhesion molecules and their ligands [BR:mmu04516]
 6. Sialomucin Family
  SPN, CD43; sialophorin [KO:K06477]
   14133 (Fcna)
Lectins [BR:mmu04091]
 Ficolins
  14133 (Fcna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 A3
AA seq 334 aa AA seqDB search
MQWPTLWAFSGLLCLCPSQALGQERGACPDVKVVGLGAQDKVVVIQSCPGFPGPPGPKGE
PGSPAGRGERGFQGSPGKMGPAGSKGEPGTMGPPGVKGEKGDTGAAPSLGEKELGDTLCQ
RGPRSCKDLLTRGIFLTGWYTIHLPDCRPLTVLCDMDVDGGGWTVFQRRVDGSIDFFRDW
DSYKRGFGNLGTEFWLGNDYLHLLTANGNQELRVDLQDFQGKGSYAKYSSFQVSEEQEKY
KLTLGQFLEGTAGDSLTKHNNMSFTTHDQDNDANSMNCAALFHGAWWYHNCHQSNLNGRY
LSGSHESYADGINWGTGQGHHYSYKVAEMKIRAS
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgcagtggcctacgctgtgggccttttcaggactgctctgtctctgtccctcccaggcc
ctgggtcaggagagaggtgcctgtccagatgttaaggtcgtaggtctgggggcccaggac
aaggtggttgtcatccaaagttgccctggctttcctggcccacctgggcccaaaggggag
cctggaagccctgctggaagaggagaacggggctttcagggcagcccaggaaagatggga
cctgccggcagcaaaggagagccaggaaccatggggcccccgggagttaaaggggagaaa
ggcgatacaggagctgcgccatctctgggtgaaaaggagctgggagacaccctgtgccag
agaggaccccggagctgcaaagacttgctgacacggggcatcttcctgactggctggtac
accatccatcttcctgactgccggccactgactgtgctctgtgacatggatgtggacggt
gggggctggaccgtttttcaacgacgagtggacgggtctatcgatttcttccgagactgg
gactcctataaaagaggctttggcaacctgggcacggagttctggttgggtaatgactac
ctgcacctgctcacagccaatgggaaccaagagctccgagttgacttacaagatttccaa
gggaaaggctcctatgccaagtacagctcattccaggtatctgaagaacaggagaaatac
aagctgaccttggggcagtttctggagggcactgcaggagactccctgacaaagcacaac
aacatgtcatttacaacccatgaccaagataatgatgcaaatagcatgaactgtgcagct
ttgttccatggagcctggtggtaccacaactgccaccagtccaacctcaacgggcgctac
ttgtctggctcccatgagagttatgcggatggcatcaactggggaactggccaaggtcac
cactactcctacaaggttgccgagatgaaaatccgagcatcttaa

DBGET integrated database retrieval system