KEGG   Mus musculus (mouse): 14182Help
Entry
14182             CDS       T01002                                 

Gene name
Fgfr1, AW208770, Eask, FLG, Fgfr-1, Flt-2, Hspy, MFR, bFGF-R-1, c-fgr
Definition
(RefSeq) fibroblast growth factor receptor 1 (EC:2.7.10.1)
  KO
K04362  
fibroblast growth factor receptor 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
PI3K-Akt signaling pathway
Adherens junction
Signaling pathways regulating pluripotency of stem cells
Regulation of actin cytoskeleton
Pathways in cancer
Proteoglycans in cancer
Prostate cancer
Melanoma
Breast cancer
Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14182 (Fgfr1)
   04015 Rap1 signaling pathway
    14182 (Fgfr1)
   04010 MAPK signaling pathway
    14182 (Fgfr1)
   04151 PI3K-Akt signaling pathway
    14182 (Fgfr1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    14182 (Fgfr1)
  Cellular community
   04520 Adherens junction
    14182 (Fgfr1)
   04550 Signaling pathways regulating pluripotency of stem cells
    14182 (Fgfr1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14182 (Fgfr1)
   05230 Central carbon metabolism in cancer
    14182 (Fgfr1)
   05205 Proteoglycans in cancer
    14182 (Fgfr1)
   05218 Melanoma
    14182 (Fgfr1)
   05215 Prostate cancer
    14182 (Fgfr1)
   05224 Breast cancer
    14182 (Fgfr1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14182 (Fgfr1)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  FGFR family [OT]
   14182 (Fgfr1)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class IV (FGF receptor family)
   14182 (Fgfr1)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class IV (FGF receptor family)
   14182 (Fgfr1)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Neural system
   5/2 subfamily
    NCAM; neural cell adhesion molecule [KO:K06491]
     14182 (Fgfr1)
   6/5 subfamily
    L1CAM; L1 cell adhesion molecule [KO:K06550]
     14182 (Fgfr1)
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type I classic cadherins
    CDH2; cadherin 2, type 1, N-cadherin [KO:K06736]
     14182 (Fgfr1)
Cellular antigens [BR:mmu04090]
 Proteins
  14182 (Fgfr1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   14182 (Fgfr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
8 A2; 8 14.12 cM
AA seq 822 aa AA seqDB search
MWGWKCLLFWAVLVTATLCTARPAPTLPEQAQPWGVPVEVESLLVHPGDLLQLRCRLRDD
VQSINWLRDGVQLVESNRTRITGEEVEVRDSIPADSGLYACVTSSPSGSDTTYFSVNVSD
ALPSSEDDDDDDDSSSEEKETDNTKPNRRPVAPYWTSPEKMEKKLHAVPAAKTVKFKCPS
SGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSIN
HTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKI
GPDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLE
ALEERPAVMTSPLYLEIIIYCTGAFLISCMLGSVIIYKMKSGTKKSDFHSQMAVHKLAKS
IPLRRQVTVSADSSASMNSGVLLVRPSRLSSSGTPMLAGVSEYELPEDPRWELPRDRLVL
GKPLGEGCFGQVVLAEAIGLDKDKPNRVTKVAVKMLKSDATEKDLSDLISEMEMMKMIGK
HKNIINLLGACTQDGPLYVIVEYASKGNLREYLQARRPPGLEYCYNPSHNPEEQLSSKDL
VSCAYQVARGMEYLASKKCIHRDLAARNVLVTEDNVMKIADFGLARDIHHIDYYKKTTNG
RLPVKWMAPEALFDRIYTHQSDVWSFGVLLWEIFTLGGSPYPGVPVEELFKLLKEGHRMD
KPSNCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRIVALTSNQEYLDLSIPLDQYSPSF
PDTRSSTCSSGEDSVFSHEPLPEEPCLPRHPTQLANSGLKRR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgtggggctggaagtgcctcctcttctgggctgtgctggtcacagccactctctgcact
gccaggccagccccaaccttgcctgaacaagctcagccctggggagtccctgtggaagtg
gagtctctcctggtccaccctggcgacctgctacagcttcgctgtcggcttcgcgatgat
gtgcagagcatcaactggctgcgggatggggtgcagctggtggagagcaaccgtacccgc
atcacaggggaggaggtggaggtgcgggactccatccccgctgactctggcctctacgct
tgcgtgaccagcagcccctctggcagcgataccacctacttctccgtcaatgtctcagat
gcactcccatcctcggaagatgatgacgacgacgatgactcctcctcggaggagaaagag
acggacaacaccaaaccaaaccgtaggcctgtagctccctactggacatccccagagaaa
atggagaagaaactgcatgcggtgcccgctgccaagacggtgaagttcaagtgcccgtcg
agtgggacacccaaccccactctgcgctggttgaaaaatggcaaagagtttaagcctgac
caccgaattggaggctacaaggttcgctatgccacctggagcatcataatggattctgtg
gtgccttctgacaagggcaactacacctgcatcgtggagaatgagtatgggagcatcaac
cacacctaccagcttgacgtcgtggaacgatctccgcaccgacccatccttcaggcaggg
ctgcctgccaacaagacagtggccctgggcagcaatgtggagttcatgtgtaaggtgtac
agcgatccgcagcctcacattcagtggctgaagcacatcgaggtgaacgggagtaagatc
gggccagacaacttgccgtatgtccagatcctgaagactgctggagttaataccaccgac
aaggaaatggaggtgcttcatctacggaatgtctcctttgaggatgcgggggagtatacg
tgcttggcgggtaactctatcggactctcccatcactctgcatggttgaccgttctggaa
gccctggaagagagaccagctgtgatgacctcaccgctctacctggagatcattatctac
tgcaccggggccttcctgatctcctgcatgttgggctctgtcatcatctataagatgaag
agcggcaccaagaagagcgacttccatagccagatggctgtgcacaagctggccaagagc
atccctctgcgcagacaggtaacagtgtcagctgactccagtgcatccatgaactctggg
gttctcctggttcggccctcacggctctcctccagcgggacccccatgctggctggagtc
tccgaatatgagctccctgaggatccccgctgggagctgccacgagacagactggtctta
ggcaaaccacttggcgagggctgcttcgggcaggtggtgttggctgaggccatcgggctg
gataaggacaaacccaaccgtgtgaccaaagtggccgtgaagatgttgaagtccgacgca
acggagaaggacctgtcggatctgatctcggagatggagatgatgaaaatgattgggaag
cacaagaatatcatcaaccttctgggagcgtgcacacaggatggtcctctttatgtcatt
gtggagtacgcctccaaaggcaatctccgggagtatctacaggcccggaggcctcctggg
ctggagtactgctataaccccagccacaaccccgaggaacagctgtcttccaaagatctg
gtatcctgtgcctatcaggtggctcggggcatggagtatcttgcctctaagaagtgtata
caccgagacctggctgctaggaacgtcctggtgaccgaggataacgtaatgaagatcgca
gactttggcttagctcgagacattcatcatatcgactactacaagaaaaccaccaacggc
cggctgcctgtgaagtggatggcccctgaggcgttgtttgaccggatctacacacaccag
agcgatgtgtggtcttttggagtgctcttgtgggagatcttcactctgggtggctcccca
taccccggtgtgcctgtggaggaacttttcaagctgctgaaggagggtcatcgaatggac
aagcccagtaactgtaccaatgagctgtacatgatgatgcgggactgctggcatgcagtg
ccctctcagagacctacgttcaagcagttggtggaagacctggaccgcattgtggccttg
acctccaaccaggagtatctggacctgtccataccgctggaccagtactcacccagcttt
cccgacacacggagctccacctgctcctcaggggaggactctgtcttctctcatgagccg
ttacctgaggagccctgtctgcctcgacaccccacccagcttgccaacagtggactcaaa
cggcgctga

DBGET integrated database retrieval system