KEGG   Mus musculus (mouse): 14227Help
Entry
14227             CDS       T01002                                 

Gene name
Fkbp2, 13kDa, FKBP-2, mFKBP13, mFKBP2
Definition
(RefSeq) FK506 binding protein 2 (EC:5.2.1.8)
  KO
K09569  
FK506-binding protein 2 [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     14227 (Fkbp2)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    14227 (Fkbp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19; 19 A
AA seq 140 aa AA seqDB search
MRLSWILTILSICLSALAAATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKLED
GTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPKIP
GGATLVFEVELLKIERRSEL
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaggctgagctggatcctgacaatactgtccatttgcctgagtgccctggcagcagcc
acgggggccgaaggcaaacggaagctgcagattggagtgaagaaacgtgtggaccactgt
cctatcaagtctagaaagggagatgtcttacacatgcactacacgggaaagctagaagat
gggacggagtttgacagcagcctaccacagaaccagccctttgttttctcccttggcact
ggccaggttatcaagggctgggaccaggggctgctggggatgtgtgaaggggaaaagcgg
aagttggtgatcccatccgagctggggtatggagagcggggagcccccccaaagatccca
ggtggagcaaccctggtgtttgaggtggagctgctcaagattgagagacgctcagaactg
tag

DBGET integrated database retrieval system