KEGG   Mus musculus (mouse): 14254Help
Entry
14254             CDS       T01002                                 

Gene name
Flt1, AI323757, Flt-1, VEGFR-1, VEGFR1, sFlt1
Definition
(RefSeq) FMS-like tyrosine kinase 1
  KO
K05096  
FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Transcriptional misregulation in cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14254 (Flt1)
   04015 Rap1 signaling pathway
    14254 (Flt1)
   04066 HIF-1 signaling pathway
    14254 (Flt1)
   04151 PI3K-Akt signaling pathway
    14254 (Flt1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14254 (Flt1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    14254 (Flt1)
  Cellular community - eukaryotes
   04510 Focal adhesion
    14254 (Flt1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    14254 (Flt1)
  Immune diseases
   05323 Rheumatoid arthritis
    14254 (Flt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14254 (Flt1)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  VEGFR family [OT]
   14254 (Flt1)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class V (VEGF receptor family)
   14254 (Flt1)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class V (VEGF receptor family)
   14254 (Flt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G3; 5 87.01 cM
AA seq 1333 aa AA seqDB search
MVSCWDTAVLPYALLGCLLLTGYGSGSKLKVPELSLKGTQHVMQAGQTLFLKCRGEAAHS
WSLPTTVSQEDKRLSITPPSACGRDNRQFCSTLTLDTAQANHTGLYTCRYLPTSTSKKKK
AESSIYIFVSDAGSPFIEMHTDIPKLVHMTEGRQLIIPCRVTSPNVTVTLKKFPFDTLTP
DGQRITWDSRRGFIIANATYKEIGLLNCEATVNGHLYQTNYLTHRQTNTILDVQIRPPSP
VRLLHGQTLVLNCTATTELNTRVQMSWNYPGKATKRASIRQRIDRSHSHNNVFHSVLKIN
NVESRDKGLYTCRVKSGSSFQSFNTSVHVYEKGFISVKHRKQPVQETTAGRRSYRLSMKV
KAFPSPEIVWLKDGSPATLKSARYLVHGYSLIIKDVTTEDAGDYTILLGIKQSRLFKNLT
ATLIVNVKPQIYEKSVSSLPSPPLYPLGSRQVLTCTVYGIPRPTITWLWHPCHHNHSKER
YDFCTENEESFILDPSSNLGNRIESISQRMTVIEGTNKTVSTLVVADSQTPGIYSCRAFN
KIGTVERNIKFYVTDVPNGFHVSLEKMPAEGEDLKLSCVVNKFLYRDITWILLRTVNNRT
MHHSISKQKMATTQDYSITLNLVIKNVSLEDSGTYACRARNIYTGEDILRKTEVLVRDSE
APHLLQNLSDYEVSISGSTTLDCQARGVPAPQITWFKNNHKIQQEPGIILGPGNSTLFIE
RVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLF
IRKLKRSSSEVKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFG
KVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACT
KQGGPLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPGLEQGQKPRLDS
VSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRRGDTRLPLKWMAPESIFDKVYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLKEGMRMRTPEYATPEIYQIMLDCWHKD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPLNAILTRNSGFTYSTPTFSEDLFKDGFAD
PHFHSGSSDDVRYVNAFKFMSLERIKTFEELSPNSTSMFEDYQLDTSTLLGSPLLKRFTW
TETKPKASMKIDLRIASKSKEAGLSDLPRPSFCFSSCGHIRPVQDDESELGKESCCSPPP
DYNSVVLYSSPPA
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctgctgggacaccgcggtcttgccttacgcgctgctcgggtgtctgcttctc
acaggatatggctcagggtcgaagttaaaagtgcctgaactgagtttaaaaggcacccag
catgtcatgcaagcaggccagactctctttctcaagtgcagaggggaggcagcccactca
tggtctctgcccacgaccgtgagccaggaggacaaaaggctgagcatcactcccccatcg
gcctgtgggagggataacaggcaattctgcagcaccttgaccttggacacggcgcaggcc
aaccacacgggcctctacacctgtagatacctccctacatctacttcgaagaaaaagaaa
gcggaatcttcaatctacatatttgttagtgatgcagggagtcctttcatagagatgcac
actgacatacccaaacttgtgcacatgacggaaggaagacagctcatcatcccctgccgg
gtgacgtcacccaacgtcacagtcaccctaaaaaagtttccatttgatactcttacccct
gatgggcaaagaataacatgggacagtaggagaggctttataatagcaaatgcaacgtac
aaagagataggactgctgaactgcgaagccaccgtcaacgggcacctgtaccagacaaac
tatctgacccatcggcagaccaatacaatcctagatgtccaaatacgcccgccgagccca
gtgagactgctccacgggcagactcttgtcctcaactgcaccgccaccacggagctcaat
acgagggtgcaaatgagctggaattaccctggtaaagcaactaagagagcatctataagg
cagcggattgaccggagccattcccacaacaatgtgttccacagtgttcttaagatcaac
aatgtggagagccgagacaaggggctctacacctgtcgcgtgaagagtgggtcctcgttc
cagtctttcaacacctccgtgcatgtgtatgaaaaaggattcatcagtgtgaaacatcgg
aagcagccggtgcaggaaaccacagcaggaagacggtcctatcggctgtccatgaaagtg
aaggccttcccctccccagaaatcgtatggttaaaagatggctcgcctgcaacattgaag
tctgctcgctatttggtacatggctactcattaattatcaaagatgtgacaaccgaggat
gcaggggactatacgatcttgctgggcataaagcagtcaaggctatttaaaaacctcact
gccactctcattgtaaacgtgaaacctcagatctacgaaaagtccgtgtcctcgcttcca
agcccacctctctatccgctgggcagcagacaagtcctcacttgcaccgtgtatggcatc
cctcggccaacaatcacgtggctctggcacccctgtcaccacaatcactccaaagaaagg
tatgacttctgcactgagaatgaagaatcctttatcctggatcccagcagcaacttagga
aacagaattgagagcatctctcagcgcatgacggtcatagaaggaacaaataagacggtt
agcacattggtggtggctgactctcagacccctggaatctacagctgccgggccttcaat
aaaatagggactgtggaaagaaacataaaattttatgtcacagatgtgccgaatggcttt
cacgtttccttggaaaagatgccagccgaaggagaggacctgaaactgtcctgtgtggtc
aataaattcctgtacagagacattacctggattctgctacggacagttaacaacagaacc
atgcaccatagtatcagcaagcaaaaaatggccaccactcaagattactccatcactctg
aaccttgtcatcaagaacgtgtctctagaagactcgggcacctatgcgtgcagagccagg
aacatatacacaggggaagacatccttcggaagacagaagttctcgttagagattcggaa
gcgccacacctgcttcaaaacctcagtgactacgaggtctccatcagtggctctacgacc
ttagactgtcaagctagaggtgtccccgcgcctcagatcacttggttcaaaaacaaccac
aaaatacaacaagaaccgggaattattttaggaccaggaaacagcacgctgtttattgaa
agagtcacagaggaggatgagggtgtctataggtgccgagccaccaaccagaagggggcc
gtggaaagcgcagcctacctcaccgtgcaaggaacctcagacaagtcaaacctggagctg
atcacgctcacgtgcacatgcgtggctgcgaccctcttttggctccttctaactctcttc
atcagaaaactgaagcggtcttcttccgaagtaaagacagactacctgtcaatcattatg
gacccagatgaagttcccctggatgagcagtgtgaacggctgccctatgatgccagcaag
tgggagtttgcacgggagagactgaaactaggcaaatcgctcggaagaggggcttttggg
aaagtcgttcaagcctctgcatttggcattaagaaatcacccacctgccggactgtggct
gtgaagatgttgaaagagggggccacagccagtgagtacaaagctctgatgaccgaactc
aagatcttgacccacatcggccatcatctgaatgtggttaacctcctgggagcctgcacg
aagcaaggagggcctctgatggtgatcgtggaatactgcaaatacggaaacctgtccaac
tacctcaagagcaaacgtgacttattctgtctcaacaaggacgcagccttgcatatggag
ctcaagaaagagagcctggaaccaggcctggagcagggccagaagccccgcctagacagt
gtcagcagctcaagtgtcaccagctccagcttccctgaagaccgaagcgtgagcgatgtg
gaaggagacgaggattacagtgagatctccaagcagcccctcaccatggaagacctgatt
tcctacagtttccaagtggccagaggcatggagtttctgtcctccagaaagtgcattcat
cgggacctggcagcgagaaacatccttttatctgagaacaatgtggtgaagatttgcgac
tttggcctggcccgggatatttataagaaccctgattatgtgaggagaggagatactcga
cttcccctaaaatggatggctcctgaatccatctttgacaaggtctacagcaccaagagc
gatgtgtggtcctatggcgtgttgctgtgggagatcttctccttagggggttctccatac
ccaggagtgcaaatggatgaagacttctgcagccgcctgaaggaaggcatgcggatgaga
accccggagtatgccacacctgaaatctaccaaatcatgttggattgctggcacaaagac
cccaaagagaggccccggtttgctgaacttgtggagaaacttggtgacctgcttcaagcc
aacgtccaacaggatgggaaagattacatccccctcaatgccatactgactagaaacagt
ggcttcacatactcgacccccaccttctctgaggaccttttcaaggacggctttgcagat
ccacattttcattccggaagctctgatgatgtgagatatgtaaacgctttcaaattcatg
agcctggaaagaatcaaaacctttgaggagctttcaccgaactccacctccatgtttgag
gactatcagctggacactagcactctgctgggctcccccttgctgaagcggttcacctgg
actgagaccaagcccaaggcctccatgaagatagacttgagaatagcgagtaaaagcaag
gaggcgggactttccgatctgccgaggcccagcttctgcttctccagctgtggccacatc
aggcccgtgcaggacgatgaatctgagctgggaaaggagtcctgctgttctccaccccca
gactacaactccgtggtgttgtactcctccccgcccgcctaa

DBGET integrated database retrieval system