KEGG   Mus musculus (mouse): 14254Help
Entry
14254             CDS       T01002                                 

Gene name
Flt1, AI323757, Flt-1, VEGFR-1, VEGFR1, sFlt1
Definition
(RefSeq) FMS-like tyrosine kinase 1 (EC:2.7.10.1)
  KO
K05096  
FMS-like tyrosine kinase 1 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
HIF-1 signaling pathway
Endocytosis
PI3K-Akt signaling pathway
Focal adhesion
Transcriptional misregulation in cancer
Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14254 (Flt1)
   04015 Rap1 signaling pathway
    14254 (Flt1)
   04066 HIF-1 signaling pathway
    14254 (Flt1)
   04151 PI3K-Akt signaling pathway
    14254 (Flt1)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14254 (Flt1)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    14254 (Flt1)
  Cellular community
   04510 Focal adhesion
    14254 (Flt1)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    14254 (Flt1)
  Immune diseases
   05323 Rheumatoid arthritis
    14254 (Flt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14254 (Flt1)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  VEGFR family [OT]
   14254 (Flt1)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class V (VEGF receptor family)
   14254 (Flt1)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class V (VEGF receptor family)
   14254 (Flt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 87.01 cM; 5 G
AA seq 1333 aa AA seqDB search
MVSCWDTAVLPYALLGCLLLTGYGSGSKLKVPELSLKGTQHVMQAGQTLFLKCRGEAAHS
WSLPTTVSQEDKRLSITPPSACGRDNRQFCSTLTLDTAQANHTGLYTCRYLPTSTSKKKK
AESSIYIFVSDAGSPFIEMHTDIPKLVHMTEGRQLIIPCRVTSPNVTVTLKKFPFDTLTP
DGQRITWDSRRGFIIANATYKEIGLLNCEATVNGHLYQTNYLTHRQTNTILDVQIRPPSP
VRLLHGQTLVLNCTATTELNTRVQMSWNYPGKATKRASIRQRIDRSHSHNNVFHSVLKIN
NVESRDKGLYTCRVKSGSSFQSFNTSVHVYEKGFISVKHRKQPVQETTAGRRSYRLSMKV
KAFPSPEIVWLKDGSPATLKSARYLVHGYSLIIKDVTTEDAGDYTILLGIKQSRLFKNLT
ATLIVNVKPQIYEKSVSSLPSPPLYPLGSRQVLTCTVYGIPRPTITWLWHPCHHNHSKER
YDFCTENEESFILDPSSNLGNRIESISQRMTVIEGTNKTVSTLVVADSQTPGIYSCRAFN
KIGTVERNIKFYVTDVPNGFHVSLEKMPAEGEDLKLSCVVNKFLYRDITWILLRTVNNRT
MHHSISKQKMATTQDYSITLNLVIKNVSLEDSGTYACRARNIYTGEDILRKTEVLVRDSE
APHLLQNLSDYEVSISGSTTLDCQARGVPAPQITWFKNNHKIQQEPGIILGPGNSTLFIE
RVTEEDEGVYRCRATNQKGAVESAAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLF
IRKLKRSSSEVKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFG
KVVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACT
KQGGPLMVIVEYCKYGNLSNYLKSKRDLFCLNKDAALHMELKKESLEPGLEQGQKPRLDS
VSSSSVTSSSFPEDRSVSDVEGDEDYSEISKQPLTMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRRGDTRLPLKWMAPESIFDKVYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLKEGMRMRTPEYATPEIYQIMLDCWHKD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPLNAILTRNSGFTYSTPTFSEDLFKDGFAD
PHFHSGSSDDVRYVNAFKFMSLERIKTFEELSPNSTSMFEDYQLDTSTLLGSPLLKRFTW
TETKPKASMKIDLRIASKSKEAGLSDLPRPSFCFSSCGHIRPVQDDESELGKESCCSPPP
DYNSVVLYSSPPA
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctgctgggacaccgcggtcttgccttacgcgctgctcgggtgtctgcttctc
acaggatatggctcagggtcgaagttaaaagtgcctgaactgagtttaaaaggcacccag
catgtcatgcaagcaggccagactctctttctcaagtgcagaggggaggcagcccactca
tggtctctgcccacgaccgtgagccaggaggacaaaaggctgagcatcactcccccatcg
gcctgtgggagggataacaggcaattctgcagcaccttgaccttggacacggcgcaggcc
aaccacacgggcctctacacctgtagatacctccctacatctacttcgaagaaaaagaaa
gcggaatcttcaatctacatatttgttagtgatgcagggagtcctttcatagagatgcac
actgacatacccaaacttgtgcacatgacggaaggaagacagctcatcatcccctgccgg
gtgacgtcacccaacgtcacagtcaccctaaaaaagtttccatttgatactcttacccct
gatgggcaaagaataacatgggacagtaggagaggctttataatagcaaatgcaacgtac
aaagagataggactgctgaactgcgaagccaccgtcaacgggcacctgtaccagacaaac
tatctgacccatcggcagaccaatacaatcctagatgtccaaatacgcccgccgagccca
gtgagactgctccacgggcagactcttgtcctcaactgcaccgccaccacggagctcaat
acgagggtgcaaatgagctggaattaccctggtaaagcaactaagagagcatctataagg
cagcggattgaccggagccattcccacaacaatgtgttccacagtgttcttaagatcaac
aatgtggagagccgagacaaggggctctacacctgtcgcgtgaagagtgggtcctcgttc
cagtctttcaacacctccgtgcatgtgtatgaaaaaggattcatcagtgtgaaacatcgg
aagcagccggtgcaggaaaccacagcaggaagacggtcctatcggctgtccatgaaagtg
aaggccttcccctccccagaaatcgtatggttaaaagatggctcgcctgcaacattgaag
tctgctcgctatttggtacatggctactcattaattatcaaagatgtgacaaccgaggat
gcaggggactatacgatcttgctgggcataaagcagtcaaggctatttaaaaacctcact
gccactctcattgtaaacgtgaaacctcagatctacgaaaagtccgtgtcctcgcttcca
agcccacctctctatccgctgggcagcagacaagtcctcacttgcaccgtgtatggcatc
cctcggccaacaatcacgtggctctggcacccctgtcaccacaatcactccaaagaaagg
tatgacttctgcactgagaatgaagaatcctttatcctggatcccagcagcaacttagga
aacagaattgagagcatctctcagcgcatgacggtcatagaaggaacaaataagacggtt
agcacattggtggtggctgactctcagacccctggaatctacagctgccgggccttcaat
aaaatagggactgtggaaagaaacataaaattttatgtcacagatgtgccgaatggcttt
cacgtttccttggaaaagatgccagccgaaggagaggacctgaaactgtcctgtgtggtc
aataaattcctgtacagagacattacctggattctgctacggacagttaacaacagaacc
atgcaccatagtatcagcaagcaaaaaatggccaccactcaagattactccatcactctg
aaccttgtcatcaagaacgtgtctctagaagactcgggcacctatgcgtgcagagccagg
aacatatacacaggggaagacatccttcggaagacagaagttctcgttagagattcggaa
gcgccacacctgcttcaaaacctcagtgactacgaggtctccatcagtggctctacgacc
ttagactgtcaagctagaggtgtccccgcgcctcagatcacttggttcaaaaacaaccac
aaaatacaacaagaaccgggaattattttaggaccaggaaacagcacgctgtttattgaa
agagtcacagaggaggatgagggtgtctataggtgccgagccaccaaccagaagggggcc
gtggaaagcgcagcctacctcaccgtgcaaggaacctcagacaagtcaaacctggagctg
atcacgctcacgtgcacatgcgtggctgcgaccctcttttggctccttctaactctcttc
atcagaaaactgaagcggtcttcttccgaagtaaagacagactacctgtcaatcattatg
gacccagatgaagttcccctggatgagcagtgtgaacggctgccctatgatgccagcaag
tgggagtttgcacgggagagactgaaactaggcaaatcgctcggaagaggggcttttggg
aaagtcgttcaagcctctgcatttggcattaagaaatcacccacctgccggactgtggct
gtgaagatgttgaaagagggggccacagccagtgagtacaaagctctgatgaccgaactc
aagatcttgacccacatcggccatcatctgaatgtggttaacctcctgggagcctgcacg
aagcaaggagggcctctgatggtgatcgtggaatactgcaaatacggaaacctgtccaac
tacctcaagagcaaacgtgacttattctgtctcaacaaggacgcagccttgcatatggag
ctcaagaaagagagcctggaaccaggcctggagcagggccagaagccccgcctagacagt
gtcagcagctcaagtgtcaccagctccagcttccctgaagaccgaagcgtgagcgatgtg
gaaggagacgaggattacagtgagatctccaagcagcccctcaccatggaagacctgatt
tcctacagtttccaagtggccagaggcatggagtttctgtcctccagaaagtgcattcat
cgggacctggcagcgagaaacatccttttatctgagaacaatgtggtgaagatttgcgac
tttggcctggcccgggatatttataagaaccctgattatgtgaggagaggagatactcga
cttcccctaaaatggatggctcctgaatccatctttgacaaggtctacagcaccaagagc
gatgtgtggtcctatggcgtgttgctgtgggagatcttctccttagggggttctccatac
ccaggagtgcaaatggatgaagacttctgcagccgcctgaaggaaggcatgcggatgaga
accccggagtatgccacacctgaaatctaccaaatcatgttggattgctggcacaaagac
cccaaagagaggccccggtttgctgaacttgtggagaaacttggtgacctgcttcaagcc
aacgtccaacaggatgggaaagattacatccccctcaatgccatactgactagaaacagt
ggcttcacatactcgacccccaccttctctgaggaccttttcaaggacggctttgcagat
ccacattttcattccggaagctctgatgatgtgagatatgtaaacgctttcaaattcatg
agcctggaaagaatcaaaacctttgaggagctttcaccgaactccacctccatgtttgag
gactatcagctggacactagcactctgctgggctcccccttgctgaagcggttcacctgg
actgagaccaagcccaaggcctccatgaagatagacttgagaatagcgagtaaaagcaag
gaggcgggactttccgatctgccgaggcccagcttctgcttctccagctgtggccacatc
aggcccgtgcaggacgatgaatctgagctgggaaaggagtcctgctgttctccaccccca
gactacaactccgtggtgttgtactcctccccgcccgcctaa

DBGET integrated database retrieval system