KEGG   Mus musculus (mouse): 14257Help
Entry
14257             CDS       T01002                                 

Gene name
Flt4, AI323512, Chy, Flt-4, VEGFR-3, VEGFR3
Definition
(RefSeq) FMS-like tyrosine kinase 4 (EC:2.7.10.1)
  KO
K05097  
FMS-like tyrosine kinase 4 [EC:2.7.10.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Ras signaling pathway
Rap1 signaling pathway
Cytokine-cytokine receptor interaction
PI3K-Akt signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    14257 (Flt4)
   04015 Rap1 signaling pathway
    14257 (Flt4)
   04151 PI3K-Akt signaling pathway
    14257 (Flt4)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14257 (Flt4)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    14257 (Flt4)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     14257 (Flt4)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  VEGFR family [OT]
   14257 (Flt4)
Enzyme-linked receptors [BR:mmu01020]
 Receptor tyrosine kinases
  RTK class V (VEGF receptor family)
   14257 (Flt4)
Cytokine receptors [BR:mmu04050]
 Receptor tyrosine kinase
  RTK class V (VEGF receptor family)
   14257 (Flt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 29.69 cM; 11 A5-B1
AA seq 1363 aa AA seqDB search
MQPGAALNLRLWLCLGLLQGLANGYSMTPPTLNITEDSYVIDTGDSLSISCRGQHPLEWT
WPGAQEVLTTGGKDSEDTRVVHDCEGTEARPYCKVLLLAQTHANNTGSYHCYYKYIKARI
EGTTAASTYVFVRDFKHPFINKPDTLLVNRKDSMWVPCLVSIPGLNITLRSQSSALHPDG
QEVLWDDRRGMRVPTQLLRDALYLQCETTWGDQNFLSNLFVVHITGNELYDIQLYPKKSM
ELLVGEKLVLNCTVWAEFDSGVTFDWDYPGKQAERAKWVPERRSQQTHTELSSILTIHNV
SQNDLGPYVCEANNGIQRFRESTEVIVHEKPFISVEWLKGPVLEATAGDELVKLPVKLAA
YPPPEFQWYKDRKAVTGRHNPHALVLKEVTEASAGVYTLALWNSAAGLRQNISLELVVNV
PPHIHEKEASSPSIYSRHSRQTLTCTAYGVPQPLSVQWHWRPWTPCKTFAQRSLRRRQQR
DGMPQCRDWKEVTTQDAVNPIESLDSWTEFVEGKNKTVSKLVIQDANVSAMYKCVVVNKV
GQDERLIYFYVTTIPDGFSIESEPSEDPLEGQSVRLSCRADNYTYEHLRWYRLNLSTLHD
AQGNPLLLDCKNVHLFATPLEANLEEAEPGARHATLSLNIPRVAPEDEGDYVCEVQDRRS
QDKHCHKKYLSVQALEAPRLTQNLTDLLVNVSDSLEMRCPVAGAHVPSIVWYKDERLLEK
ESGIDLADSNQRLSIQRVREEDAGRYLCSVCNAKGCVNSSASVAVEGSEDKGSMEIVILI
GTGVIAVFFWVLLLLIFCNMKRPAHADIKTGYLSIIMDPGEVPLEEQCEYLSYDASQWEF
PRERLHLGRVLGHGAFGKVVEASAFGINKGSSCDTVAVKMLKEGATASEHRALMSELKIL
IHIGNHLNVVNLLGACTKPNGPLMVIVEFCKYGNLSNFLRVKRDTFNPYAEKSPEQRRRF
RAMVEGAKADRRRPGSSDRALFTRFLMGKGSARRAPLVQEAEDLWLSPLTMEDLVCYSFQ
VARGMEFLASRKCIHRDLAARNILLSESDIVKICDFGLARDIYKDPDYVRKGSARLPLKW
MAPESIFDKVYTTQSDVWSFGVLLWEIFSLGASPYPGVQINEEFCQRLKDGTRMRAPELA
TPAIRHIMQSCWSGDPKARPAFSDLVEILGDLLQGGGWQEEEEERMALHSSQSSEEDGFM
QASTTALHITEADADDSPPSMHCHSLAARYYNCVSFPGRLARGTKTPGSSRMKTFEELPM
TPTTYKASMDNQTDSGMVLASEEFEELESRHRPEGSFSCKGPGQHMDIPRGHPDPQGRRR
RPTQGAQGGKVFYNNEYGEVSQPCTEGDCCPSAGSTFFADSSY
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgggcgctgcgctgaacctgcgcctgtggctctgcctcggactcctccaaggc
ctggcaaatggttactccatgacccctccaaccctgaacatcacagaggattcatatgtg
attgacaccggggacagcctatccatatcctgcaggggacagcaccccctcgagtggacc
tggccaggggcccaggaggtactgaccacaggtgggaaggacagtgaagacacacgggtt
gtgcatgactgtgaaggcacagaagctaggccctactgcaaggtgctactgctggcccag
actcacgccaacaacacgggcagctaccactgctactacaagtacatcaaggcccggatt
gagggcaccacagctgccagcacctatgtgtttgtaagagactttaaacaccctttcatc
aacaaacctgacacgctcctggtcaacaggaaggactcgatgtgggtgccctgcttggtg
tccattcccggcctcaacatcacactgcgctcgcaaagctcagcgctgcaccccgacggg
caggaggtgctgtgggatgaccgccggggcatgcgggtgcccactcaactgttgcgcgat
gccctgtacctgcagtgcgagaccacctggggtgaccagaacttcctttccaatctcttc
gtcgtgcacatcacaggcaatgagctctatgacatccagctgtaccccaagaagtcaatg
gagctgttggttggagagaagctggttttgaactgtacagtgtgggctgagttcgactca
ggtgtcaccttcgactgggattatccagggaagcaggcagagcgggctaagtgggtacct
gagcggcgttcccagcagacccacacagaactctccagcatcctgaccatccacaatgtc
agccagaatgacctgggcccctatgtgtgtgaggccaacaatgggattcagcggttccgg
gaaagcacagaggtcattgtgcacgaaaagcccttcatcagtgtcgagtggctcaaagga
cctgtcctggaggccacagccggtgacgagctggtgaagctacccgtgaagctggcagct
tatcccccaccggagttccaatggtacaaggacagaaaggcagtgactgggcgccacaat
ccccatgctctggtgctcaaagaggtgaccgaggccagcgcaggggtctacactctcgcc
ctgtggaactctgcagctggtctgaggcaaaacatcagtctggagctggtggtgaatgtg
cctcctcacatccacgaaaaggaagcctcttcacccagcatctactcccgccacagtcgc
cagaccctcacctgcaccgcctatggagtaccccaacccctcagtgtccagtggcactgg
aggccctggacaccctgcaagacgtttgcccagcgcagcctccggaggcggcagcagcgg
gatggcatgccacagtgccgagactggaaggaggtgaccactcaggatgctgtgaacccc
atcgagagtctggacagctggacggagtttgtggaggggaagaataagacggtgagcaag
ctggtgatccaggatgccaatgtgtcagccatgtacaagtgtgtggtcgtcaacaaagtg
ggccaggatgagagactcatctacttctatgtgaccaccatcccggacggtttcagtatc
gagtcggagccttctgaggatcccttagaaggccagtccgtgcgcctcagctgccgggcg
gacaactacacgtacgaacatctgcgctggtaccggctcaacctctccacactgcacgat
gctcaagggaaccccctattgctggactgcaaaaacgtgcacctgtttgccacgccccta
gaggccaacctagaggaggcagagcccggggcccgccacgccaccctcagtttgaatatc
ccccgagtggcgcccgaggacgagggtgactacgtgtgtgaagtgcaggataggcgcagc
caggacaagcactgccacaagaagtacctgtccgtgcaggccctggaagctcctcggctc
acgcagaacttgaccgacctcctggtgaacgtgagtgactccctggagatgcgatgcccg
gtggctggagcgcatgtgcccagtattgtgtggtacaaagatgaaaggctcctggagaaa
gagtcgggaatcgacctggcagactccaatcagaggctgagcatccagcgcgtgcgcgag
gaggacgcaggtcgttatctgtgcagcgtgtgcaatgccaagggctgcgtaaactcctct
gccagcgtggcagtggaaggctctgaagataaaggcagcatggagattgtgatactcatt
ggcactggcgtcatcgcagttttcttctgggtcctcctcctgctcatcttctgtaacatg
aaaaggcctgcccatgcagacatcaagacgggctacctgtccatcatcatggaccccggg
gaggtgcctttggaggagcagtgtgaatacctgtcctatgacgccagccagtgggagttc
cccagggaaaggttgcacctcgggagagtcctaggccacggggcttttgggaaggtggtg
gaagcctcagcttttggcatcaataaaggcagcagctgtgacaccgtggctgtgaagatg
ctgaaagagggcgctactgccagcgagcaccgtgccctgatgtcggagctcaagatccta
attcacatcggcaaccatctcaacgtggtcaacctcctaggggcgtgcaccaagcccaac
ggccctctcatggtgatcgtggagttttgcaaatacggcaacctctccaacttcttgcgt
gtcaagcgggacacgttcaacccctacgcggagaagtctccggagcaacgcaggcgcttc
cgcgccatggtagaaggcgccaaagctgataggaggagacctggaagcagcgacagggcc
ctgttcacgcggttcctgatgggcaaaggaagtgcacggcgagccccacttgtccaagaa
gctgaggacctatggctgagcccactgaccatggaagaccttgtatgctacagcttccaa
gttgcccggggaatggagttcctggcttcccgcaagtgcattcacagagacctggctgct
cggaacatcctactgtcagaaagtgacatagtgaagatctgcgactttggcctcgctcgg
gacatctacaaagaccccgactatgtccgaaagggcagtgcccgacttcctctgaaatgg
atggcccccgagagcatctttgataaggtgtacaccacgcagagtgatgtgtggtccttc
ggcgtgctgctgtgggagatcttctcattgggggcctctccataccctggggtacagatc
aatgaggagttctgccagcggctgaaggatggcactcgaatgagagccccggaactggcc
actcctgccatacgccacatcatgcagagttgctggtctggagaccctaaagcaagacct
gctttctctgacctagtggagatcctgggggacctgcttcagggcggaggctggcaggag
gaggaagaggagcgcatggccctgcacagctctcagagctccgaggaggatggcttcatg
caggcatccaccacagctctacatatcaccgaagcagacgctgatgatagtccacccagc
atgcattgccacagcctggcagccagatattacaactgtgtgtcctttcctgggcgcctg
gccagaggcactaagactccaggctcttccaggatgaagacatttgaagaattgcccatg
acccctacaacctacaaagcctccatggataaccagacagacagcgggatggtgctggcc
tcagaagagtttgaggagctagaaagcaggcatagaccagaaggcagcttcagctgtaaa
ggtcctggccagcacatggatattcccagaggacaccctgacccccaggggaggcggcga
cggcccactcaaggggcacaaggaggcaaggtgttttataacaacgagtatggggaggtc
tcccagccatgtacagaaggtgactgctgcccgtctgctggctccaccttcttcgcagac
agcagctactaa

DBGET integrated database retrieval system