KEGG   Mus musculus (mouse): 14289Help
Entry
14289             CDS       T01002                                 

Gene name
Fpr2, E330010I07Rik, Fpr-rs2
Definition
(RefSeq) formyl peptide receptor 2
  KO
K04173  
formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14289 (Fpr2)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    14289 (Fpr2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   fMet-Leu-Phe
    14289 (Fpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
17; 17 A3.2
AA seq 351 aa AA seqDB search
MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT
TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIA
LDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNF
GSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPM
LYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaactactccatccatctgaatggatcagaagtggtggtttatgattctacc
atctccagagttctgtggatcctctcaatggtggttgtctccatcactttcttccttggt
gtgctgggcaatggactagtgatttgggtagctggattccggatgccacacactgtcacc
actatctggtatctgaatctagcattggctgacttttctttcacagcaactctaccattc
cttcttgttgaaatggctatgaaagaaaaatggccttttggctggttcctgtgtaaatta
gttcacattgtggtagatgtaaacctgtttggaagtgtcttcttgattgctctcattgcc
ttggaccgctgcatttgtgttctgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctaggaaggtggttgttgggccctggatttttgctctgattctcactttgcccatt
tttattttcttgactactgttagaattcctggaggagatgtgtattgtacattcaacttt
ggatcctgggctcaaactgatgaagaaaagttgaacacagctatcacttttgtaacaact
agagggatcatcaggttccttattggtttcagcatgcccatgtcaattgttgctgtttgc
tatggactcattgctgtcaagatcaacagaagaaaccttgttaattccagccgtccttta
cgagtccttacagcagttgtggcttccttctttatctgctggtttccctttcagcttgtg
gcccttttgggcacagtctggtttaaagagacattgcttagtggtagttataaaattctt
gacatgtttgttaacccaacaagctcattggcttacttcaatagttgtctcaatccgatg
ctctatgttttcatgggccaggactttcgtgagagatttattcattccctgccttatagt
cttgagagagccctgagtgaggattctggtcaaaccagtgattcaagcaccagttctact
tcacctcctgcagacattgagttaaaggccccatga

DBGET integrated database retrieval system