KEGG   Mus musculus (mouse): 14289Help
Entry
14289             CDS       T01002                                 

Gene name
Fpr2, E330010I07Rik, Fpr-rs2
Definition
(RefSeq) formyl peptide receptor 2
  KO
K04173  formyl peptide receptor-like
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14289 (Fpr2)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    14289 (Fpr2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   fMet-Leu-Phe
    14289 (Fpr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 14289
NCBI-ProteinID: NP_032065
MGI: 1278319
Ensembl: ENSMUSG00000052270
Vega: OTTMUSG00000021056
UniProt: O88536
Position
17; 17 A3.2
AA seq 351 aa AA seqDB search
MESNYSIHLNGSEVVVYDSTISRVLWILSMVVVSITFFLGVLGNGLVIWVAGFRMPHTVT
TIWYLNLALADFSFTATLPFLLVEMAMKEKWPFGWFLCKLVHIVVDVNLFGSVFLIALIA
LDRCICVLHPVWAQNHRTVSLARKVVVGPWIFALILTLPIFIFLTTVRIPGGDVYCTFNF
GSWAQTDEEKLNTAITFVTTRGIIRFLIGFSMPMSIVAVCYGLIAVKINRRNLVNSSRPL
RVLTAVVASFFICWFPFQLVALLGTVWFKETLLSGSYKILDMFVNPTSSLAYFNSCLNPM
LYVFMGQDFRERFIHSLPYSLERALSEDSGQTSDSSTSSTSPPADIELKAP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atggaatccaactactccatccatctgaatggatcagaagtggtggtttatgattctacc
atctccagagttctgtggatcctctcaatggtggttgtctccatcactttcttccttggt
gtgctgggcaatggactagtgatttgggtagctggattccggatgccacacactgtcacc
actatctggtatctgaatctagcattggctgacttttctttcacagcaactctaccattc
cttcttgttgaaatggctatgaaagaaaaatggccttttggctggttcctgtgtaaatta
gttcacattgtggtagatgtaaacctgtttggaagtgtcttcttgattgctctcattgcc
ttggaccgctgcatttgtgttctgcatccagtctgggctcagaaccaccgcactgtgagc
ctggctaggaaggtggttgttgggccctggatttttgctctgattctcactttgcccatt
tttattttcttgactactgttagaattcctggaggagatgtgtattgtacattcaacttt
ggatcctgggctcaaactgatgaagaaaagttgaacacagctatcacttttgtaacaact
agagggatcatcaggttccttattggtttcagcatgcccatgtcaattgttgctgtttgc
tatggactcattgctgtcaagatcaacagaagaaaccttgttaattccagccgtccttta
cgagtccttacagcagttgtggcttccttctttatctgctggtttccctttcagcttgtg
gcccttttgggcacagtctggtttaaagagacattgcttagtggtagttataaaattctt
gacatgtttgttaacccaacaagctcattggcttacttcaatagttgtctcaatccgatg
ctctatgttttcatgggccaggactttcgtgagagatttattcattccctgccttatagt
cttgagagagccctgagtgaggattctggtcaaaccagtgattcaagcaccagttctact
tcacctcctgcagacattgagttaaaggccccatga

DBGET integrated database retrieval system