KEGG   Mus musculus (mouse): 14302Help
Entry
14302             CDS       T01002                                 

Gene name
Frk, BSK, BSK/IYK, C85044, GTK, RAK
Definition
(RefSeq) fyn-related kinase (EC:2.7.10.2)
  KO
K08892  
fyn-related kinase [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     14302 (Frk)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   14302 (Frk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
10; 10 B1
AA seq 512 aa AA seqDB search
MGSVCVRLWAYLQPFLPCWSQEADKSVVIENPGAFCPPEAPRSQEPERSHGQYFVALFDY
QARTAEDLSFRAGDKLQVLDTSHEGWWLARHLEKKGTGLGQQLQGYIPSNYVAEDRSLQA
EPWFFGAIKRADAEKQLLYSENQTGAFLIRESESQKGDFSLSVLDEGVVKHYRIRRLDEG
GFFLTRRKVFSTLNEFVNYYTTTSDGLCVKLEKPCLKIQVPTPFDLSYKTADQWEIDRNS
IQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKSLRHPKLIQLY
AVCTLEDPIYIITELMRHGSLQEYLQNDGGSKIHLIQQVDMAAQVASGMAYLESQNYIHR
DLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESKHEIKLPVKWTAPEAIRTNKFSIK
SDVWSFGILLYEIITYGKMPYSGMTGAQVIQMLSQNYRLPQPSNCPQQFYSIMLECWNVE
PKQRPTFETLHWKLEDYFETDCSYSDTNNFIN
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggcagcgtctgtgtgagactctgggcatacctgcagccttttctcccgtgctggtct
caagaggcagacaagtcagtagtaattgagaatccaggggccttctgtcccccagaggct
cccaggtcacaagagcccgagagaagccatggccagtattttgtggctctgtttgattac
caagcacgtactgcagaggacctgagcttccgtgccggcgacaaactccaagtcttggac
acttcgcatgagggctggtggttggccagacatttggagaagaagggaaccggcttaggt
cagcagctacagggctacattccttccaattacgtggcggaggaccggagtctccaggca
gagccgtggttttttggagcaatcaaaagagcagatgcagaaaaacaacttctgtattca
gaaaaccagacgggcgcctttctaatcagagagagtgagagccagaagggtgacttttcc
ctctcagttttagatgaaggtgttgtaaaacactacagaataagaaggttggatgaaggt
ggcttcttcctcaccaggaggaaagtcttttcaaccctgaatgaattcgtgaactactac
accacaacaagtgacgggctgtgtgtcaagctggagaagccatgcttaaagatccaggta
ccaaccccttttgatttgtcatataaaactgcagaccagtgggagatagaccgcaactcc
atacagcttttgaagcgactgggatctggtcagtttggagaagtttgggaaggtctgtgg
aataataccactccagtggccgtaaaaacgttaaaaccaggttcaatggatccaaatgac
ttcctgagggaggcacagataatgaagagcctaagacacccaaaactcatccagctctat
gctgtttgcactttagaagatcccatttatattattacagagttgatgagacatggaagc
ctgcaagaatatctccaaaatgatggtgggtcaaaaatccatttgattcaacaggtagac
atggcggcacaggtggcttctggaatggcctatcttgagtcgcagaactatattcacaga
gatctggctgcaagaaatgtccttgttggtgaacataatatctacaaagtagcagatttt
ggacttgcaagagtttttaaggtagataatgaagacatctatgaatctaaacacgaaata
aagctgccagtgaagtggactgcacccgaagccattcgtactaataaattcagcattaag
tctgatgtgtggtcttttggaatcctgctctatgaaatcattacttatggcaaaatgcct
tacagtggtatgacaggtgctcaagtaattcaaatgttgagtcaaaactacagacttcca
cagccatctaactgcccacagcaattctacagcatcatgctagagtgctggaatgttgag
cctaagcaacggccaacatttgagaccctgcattggaaacttgaagactactttgaaaca
gactgttcctattcagatacaaataacttcataaactaa

DBGET integrated database retrieval system