KEGG   Mus musculus (mouse): 14312Help
Entry
14312             CDS       T01002                                 

Gene name
Brd2, AW228947, D17H6S113E, Frg-1, Fsrg-1, Fsrg1, Nat, Ring3, Rnf3, mKIAA4005
Definition
(RefSeq) bromodomain containing 2
  KO
K08871  bromodomain-containing protein 2
Organism
mmu  Mus musculus (mouse)
Brite
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  BRD family [OT]
   14312 (Brd2)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic Type
  Chromatin remodeling factors
   Other chromatin remodeling factors
    14312 (Brd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bromodomain BET Sigma70_ner AF-4
Motif
Other DBs
NCBI-GeneID: 14312
NCBI-ProteinID: NP_001191902
MGI: 99495
Ensembl: ENSMUSG00000024335
Vega: OTTMUSG00000017279
UniProt: Q7JJ13 B2RS09
Position
17 B1; 17 17.98 cM
AA seq 798 aa AA seqDB search
MLQNVTPHKLPGEGNAGLLGLGPEAAAPGKRIRKPSLLYEGFESPTMASVPALQLAPANP
PPPEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPM
DMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQKVASMP
QEEQELVVTIPKNSHKKGAKLAALQGSITSAHQVPAVSSVSHTALYTPPPEIPTTVLNIP
HPSVISSPLLKSLHSAGPPLLAVSAAPPAQPLAKKKGVKRKADTTTPTPTAILAPGSPAS
PPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGILKELL
SKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFAADVRLM
FSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLEPGPLPVSTALPPGLTKSSSESS
SEESSSESSSEEEEEEEEDEDEEESESSDSEEERAHRLAELQEQLRAVHEQLAALSQGPI
SKPKRKREKKEKKKKRKAEKHRGRIGIDEDDKGPRAPRPPQPKKSKKAGGGGSNATTLSH
PGFGTSGGSSNKLPKKSQKTAPPVLPTGYDSEEEEESRPMSYDEKRQLSLDINKLPGEKL
GRVVHIIQAREPSLRDSNPEEIEIDFETLKPSTLRELERYVLSCLRKKPRKPYTIRKPVG
KTKEELALEKKRELEKRLQDVSGQLNSTKKPPKKASEKTESSAQQVAVSRLSASSSSSDS
SSSSSSSSSSDTSDSDSG
NT seq 2397 nt NT seq  +upstreamnt  +downstreamnt
atgctgcaaaacgtgactccccacaagctccctggggaagggaatgcagggttactgggg
ctgggcccagaggcagcagcaccagggaaaaggattcgaaagccttctctgctgtatgag
ggatttgagagccccacaatggcttctgtaccagctttacaactggcccctgccaatcca
ccaccccctgaggtgtccaatcccaaaaagccaggacgggtaacaaaccaactgcagtac
ctgcacaaggtagtgatgaaggctctgtggaagcatcagtttgcatggccattccggcag
cctgtggacgctgtgaagctgggtttgccggattatcacaaaattataaaacagcctatg
gacatgggtactatcaagaggagacttgaaaacaattactactgggctgcctcagaatgt
atgcaggattttaatactatgtttaccaactgttacatttataacaagcccaccgatgat
attgtcctaatggcacagacactggaaaagatcttcctacagaaagtagcatccatgcca
caagaggagcaagagcttgtggtgaccatccctaaaaacagccataagaagggggccaag
ttagcagcactccagggcagtattaccagtgcccatcaggtgcctgctgtctcttctgtg
tcgcatacagccctgtatacaccaccacctgaaatacctaccactgtcctcaacattccc
cacccatcagtcatctcttctcctcttcttaagtccctgcattctgctggacccccactc
cttgctgtatcagcagcgcctccagctcagccccttgccaagaaaaaaggcgttaaacgg
aaagcggatactaccacccctacacccacagccatcctggctcctggttccccagctagt
cctcctgggagtcttgagccaaaggcagcaaggctccctcctatgcgcagagagagtggc
cgcccaatcaaacccccacgaaaagacttgcctgactcgcaacagcaacaccagagctct
aagaaagggaagctgtcagagcagttaaagcactgcaacggcatcctgaaggaactgctc
tcaaagaagcacgctgcctacgcctggcccttctataagccagtggacgcttctgctctt
ggccttcatgattaccatgacatcattaaacaccccatggacctcagcactgtcaagcgg
aagatggagaaccgtgactaccgggatgcacaggagtttgctgctgatgtacggcttatg
ttctccaactgctataagtacaatcctccagaccacgatgttgtggctatggcacgaaag
ttgcaggatgtgtttgagtttcgctatgccaagatgccagatgagccactggaaccagga
cctctaccagtctctactgccttgcctcctgggttgaccaaatcctcttcagagtcctcc
agtgaggaaagtagcagtgagagttcctctgaggaagaggaggaggaggaagaagatgag
gacgaggaggagagtgaaagctcagactctgaggaggaaagggctcatcgcctagcagag
ctgcaggagcagcttcgggcagttcatgaacaactggctgccctgtcccagggcccaata
tctaagcccaagcggaagagagagaaaaaggaaaaaaagaagaaacggaaggcagagaaa
catcgtggccgaattgggatcgatgaagatgataaggggcctagggcacctcgcccacct
cagcccaagaaatctaagaaagcaggtggtgggggtagcaatgctactacactcagccat
cctggctttgggacttccggaggaagtagcaacaagctacctaaaaagtctcaaaagaca
gctccacctgtccttcccactggctatgattctgaggaggaggaagaaagcaggcccatg
agttatgatgagaagagacagttaagcctggatatcaataagttacctggggaaaagctg
ggtcgagtagtacatatcatccaagccagggaaccctctctacgtgattcaaatccagaa
gaaattgagattgattttgaaacactcaagccgtccacacttagagagcttgagcgatat
gttttatcctgccttcgaaagaaaccccggaagccctacactattaggaaacctgtggga
aaaacaaaggaggaactggctttggagaagaagcgggagctagagaagcggttgcaggat
gtcagtggacagctcaactccaccaaaaagcctcccaagaaagcgagtgagaagacagag
tcatctgcacagcaagtggcagtgtcccgtctcagtgcttctagttccagctcagattcc
agctcctcgtcgtcatcttcctcttcttcagacaccagcgattcagactcgggctaa

DBGET integrated database retrieval system