KEGG   Mus musculus (mouse): 14360Help
Entry
14360             CDS       T01002                                 

Gene name
Fyn, AI448320, AW552119
Definition
(RefSeq) Fyn proto-oncogene (EC:2.7.10.2)
  KO
K05703  
tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid signaling pathway
Phospholipase D signaling pathway
Axon guidance
Osteoclast differentiation
Focal adhesion
Adherens junction
Platelet activation
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
Fc epsilon RI signaling pathway
Cholinergic synapse
Prion diseases
Measles
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    14360 (Fyn)
   04071 Sphingolipid signaling pathway
    14360 (Fyn)
 Cellular Processes
  Cellular community
   04510 Focal adhesion
    14360 (Fyn)
   04520 Adherens junction
    14360 (Fyn)
 Organismal Systems
  Immune system
   04611 Platelet activation
    14360 (Fyn)
   04650 Natural killer cell mediated cytotoxicity
    14360 (Fyn)
   04660 T cell receptor signaling pathway
    14360 (Fyn)
   04664 Fc epsilon RI signaling pathway
    14360 (Fyn)
  Nervous system
   04725 Cholinergic synapse
    14360 (Fyn)
  Development
   04360 Axon guidance
    14360 (Fyn)
   04380 Osteoclast differentiation
    14360 (Fyn)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    14360 (Fyn)
  Cardiovascular diseases
   05416 Viral myocarditis
    14360 (Fyn)
  Infectious diseases
   05162 Measles
    14360 (Fyn)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     14360 (Fyn)
Protein kinases [BR:mmu01001]
 Tyrosine protein kinases
  Src family
   14360 (Fyn)
Membrane trafficking [BR:mmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    14360 (Fyn)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    14360 (Fyn)
Cell adhesion molecules and their ligands [BR:mmu04516]
 1. Immunoglobulin Superfamily
  Immune system
   CD2 family
    CD48, BCM1; CD48 antigen [KO:K06479]
     14360 (Fyn)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10 B1; 10 20.51 cM
AA seq 537 aa AA seqDB search
MGCVQCKDKEAAKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQGFLEDYFTATEPQYQPGENL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcagcgaaactgacagaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggcgtgacctccatcccgaactacaacaacttccacgcagctgggggccaggga
ctcaccgtctttgggggtgtgaactcctcctctcacactgggaccctacgcacgagagga
gggacaggagtgacactgtttgtggcgctttatgactatgaagcacggacggaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagactggtgg
gaagcccgctccttgacaaccggggaaactggttacattcccagcaattacgtggctcca
gttgactccatccaggcagaagagtggtactttggaaaacttggccgcaaagatgctgag
agacagctcctgtcctttggaaacccaagaggtacctttcttatccgcgagagcgaaacc
accaaaggtgcctactcactttccatccgtgattgggatgatatgaaaggggaccacgtc
aaacattataaaatccgcaagcttgacaatggtggatactatatcacaacgcgggcccag
tttgaaacacttcagcaactggtacagcattactcagagagagccgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaatacaaaagtagccataaagacc
cttaagccaggcaccatgtctccggagtccttcctggaggaggcgcagatcatgaagaag
ctgaagcatgacaagctggtgcagctctacgcggtcgtgtctgaggagcccatttacatc
gtcacggagtacatgagcaaaggaagtttgcttgacttcttaaaagatggtgaaggaaga
gctctgaagttgccaaaccttgtggacatggcggcacaggttgctgcaggaatggcttac
atcgagcgcatgaattatatccacagagatctgcgatcagcaaacattctagtggggaat
ggactaatttgcaagattgctgactttggattggctcggttgattgaagacaatgaatac
acagcaagacaaggtgcgaagtttcccattaagtggacagcccccgaagcggccctgtat
ggaaggttcacaatcaagtctgacgtatggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
agaggctataggatgccctgcccacaggactgcccgatctccctgcacgagctcatgatc
cactgctggaaaaaggatccggaagagcgcccgaccttcgagtacttgcagggcttcctg
gaggactactttacggccacagagccccagtatcagcccggtgaaaacctgtga

DBGET integrated database retrieval system