KEGG   Mus musculus (mouse): 14368Help
Entry
14368             CDS       T01002                                 

Gene name
Fzd6, Fz6
Definition
(RefSeq) frizzled class receptor 6
  KO
K02376  
frizzled 6
Organism
mmu  Mus musculus (mouse)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    14368 (Fzd6)
   04390 Hippo signaling pathway
    14368 (Fzd6)
   04150 mTOR signaling pathway
    14368 (Fzd6)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14368 (Fzd6)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    14368 (Fzd6)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14368 (Fzd6)
   05205 Proteoglycans in cancer
    14368 (Fzd6)
   05217 Basal cell carcinoma
    14368 (Fzd6)
   05224 Breast cancer
    14368 (Fzd6)
  Infectious diseases
   05166 HTLV-I infection
    14368 (Fzd6)
G protein-coupled receptors [BR:mmu04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    14368 (Fzd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 B3.1; 15 15.22 cM
AA seq 709 aa AA seqDB search
MERSPFLLACILLPLVRGHSLFTCEPITVPRCMKMTYNMTFFPNLMGHYDQGIAAVEMGH
FLHLANLECSPNIEMFLCQAFIPTCTEQIHVVLPCRKLCEKIVSDCKKLMDTFGIRWPEE
LECNRLPHCDDTVPVTSHPHTELSGPQKKSDQVPRDIGFWCPKHLRTSGDQGYRFLGIEQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGDTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGAPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRITWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFFKRNRKRDPISESRRVLQESCEFFLKHNSKVKHK
KKHGAPGPHRLKVISKSMGTSTGATTNHGTSAMAIADHDYLGQETSTEVHTSPEASVKEG
RADRANTPSAKDRDCGESAGPSSKLSGNRNGRESRAGGLKERSNGSEGAPSEGRVSPKSS
VPETGLIDCSTSQAASSPEPTSLKGSTSLPVHSASRARKEQGAGSHSDA
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggaaaggtccccgtttctgttggcgtgcattcttctgcccctcgtaagaggacacagc
cttttcacctgtgagccaatcaccgttcccagatgtatgaaaatgacttacaacatgacg
ttcttccctaacctgatgggtcattatgaccaggggatcgctgctgtggaaatggggcac
tttctgcatcttgcaaatctagaatgttcaccaaacattgaaatgttcctttgccaagct
tttataccaacctgcacagagcaaattcatgtagttctaccctgtcggaaattgtgtgag
aaaatagtttctgattgcaaaaaactaatggacacttttggcatccgatggcctgaagaa
cttgaatgtaacagattgccacactgtgatgacactgttcctgtaacttctcatccacac
acagagctttctgggccacagaagaaatcagatcaagtcccaagagacattggattttgg
tgtccaaagcaccttaggacttccggggaccaaggctataggtttctgggaattgaacag
tgtgcccctccgtgccccaatatgtattttaaaagtgatgaactagactttgccaaaagt
ttcataggaatagtttcaatattttgtctttgtgcaactctgttcacgttccttacattt
ttaattgacgttagacgattcagatacccagagagaccaattatctattactctgtctgc
tacagcattgtctctctcatgtacttcgtggggtttttgctgggcaatagcacggcttgt
aataaggcagacgagaagctggagctcggggacaccgttgtcctagggtcaaagaataag
gcttgcagtgtggtatttatgtttctgtatttttttacaatggctggcaccgtgtggtgg
gtgattctcaccattacgtggttcttagctgccgggagaaaatggagttgcgaagctatt
gaacaaaaagcagtgtggttccatgccgttgcctggggggcgcccgggttcctgaccgtc
atgctgctcgctatgaataaggttgaaggagacaacattagcggcgtttgcttcgttggc
ctgtatgacctggacgcctctcgctacttcgtccttctgcctctgtgcctctgcgtattt
gttgggctgtctctcctcttagccggcatcatctccttgaatcatgtccgacaagtcata
cagcatgatggccggaaccaagagaagctaaagaaattcatgattcgcatcggagtcttc
agtggcctgtatcttgtgcccttagtgacacttctcggttgctatgtctatgagctagtg
aacaggatcacctgggagatgacatggttctctgatcattgtcaccagtaccgcatcccg
tgcccttaccaggcaaatccaaaagctcgaccagaattggctttatttatgataaaatat
ctgatgacattaattgttggtatctctgcggtcttctgggttggaagcaaaaagacgtgc
acagaatgggccgggttctttaagcgaaaccgcaagcgagaccccatcagtgagagccgc
cgagtgctgcaagagtcctgtgagttcttcctgaagcacaactctaaagtgaagcacaag
aagaagcatggcgcaccagggcctcataggctgaaggtcatttccaagtccatgggaact
agcacaggagcgaccacaaatcatggcacctctgccatggcaatcgctgaccatgattac
ttagggcaagaaacttcaacagaagtccacacctccccagaagcatccgtcaaagaggga
cgagcagaccgagcaaacactcccagcgccaaagatcgggactgtggggaatctgcaggg
cccagttccaagctctctgggaaccggaacggcagggaaagccgagcgggcggcctgaag
gagagaagcaatggatcagagggggctccaagtgaaggaagggtaagtccaaagagcagc
gttcctgagactggcctgatagactgcagcacttcacaggccgccagttctccagaacca
accagcctcaagggctccacatctctgcctgttcactcagcttccagagctaggaaagag
cagggtgctggcagccattccgacgcttga

DBGET integrated database retrieval system