KEGG   Mus musculus (mouse): 14369Help
Entry
14369             CDS       T01002                                 

Gene name
Fzd7, Fz7
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  
frizzled 1/7
Organism
mmu  Mus musculus (mouse)
Pathway
mTOR signaling pathway
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Human papillomavirus infection
HTLV-I infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Module
Wnt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    14369 (Fzd7)
   04390 Hippo signaling pathway
    14369 (Fzd7)
   04150 mTOR signaling pathway
    14369 (Fzd7)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14369 (Fzd7)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    14369 (Fzd7)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14369 (Fzd7)
   05205 Proteoglycans in cancer
    14369 (Fzd7)
   05225 Hepatocellular carcinoma
    14369 (Fzd7)
   05217 Basal cell carcinoma
    14369 (Fzd7)
   05224 Breast cancer
    14369 (Fzd7)
  Infectious diseases
   05166 HTLV-I infection
    14369 (Fzd7)
   05165 Human papillomavirus infection
    14369 (Fzd7)
G protein-coupled receptors [BR:mmu04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    14369 (Fzd7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 C2; 1 30.08 cM
AA seq 572 aa AA seqDB search
MRGPGTAASHSPLGLCALVLALLGALPTDTRAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGAGGSPTAYP
TAPYLPDPPFTAMSPSDGRGRLSFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRANGL
MYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVAVA
HVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLTWF
LAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDALR
GFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTVPA
TIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFSPMSPDFTVFMIKYLMTMIVGI
TTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgcggggccccggcacggcggcgtcgcactcgcccctgggcctctgcgccctggtgctt
gctcttctgggcgcgctgcccacggacacccgggctcagccatatcacggcgagaaaggc
atctcggtaccggaccacggcttctgccagcccatctccatcccgttgtgcacggatatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctaccctctggtaaaggtgcagtgttctcctgagctacgcttc
ttcttatgctctatgtacgcacccgtgtgcaccgtgctcgaccaagccattcctccgtgc
cgttccttgtgcgagcgcgcccgacagggctgcgaggcgctcatgaacaagttcggcttc
cagtggccagagcggttgcgctgcgagaacttcccagtgcacggtgccggcgagatctgc
gtggggcagaacacgtccgacggctccgggggcgcgggcggcagtcccaccgcctaccct
actgctccctacctgccagacccacctttcactgcgatgtccccctcagatggcagaggc
cgcttgtctttccccttctcgtgtccgcgccagctcaaggtgcccccctacctgggctac
cgcttcctaggtgagcgtgactgcggtgccccgtgtgagccgggccgtgctaacggcctc
atgtactttaaagaagaggagagacggttcgcccgcctctgggtgggtgtgtggtcagtg
ctgtgctgcgcctcgacgctcttcacggtgctcacctacctagtggacatgcgtcgcttc
agctatccagagcgacccatcatcttcctgtcgggttgctacttcatggtggcagtggcg
cacgtggcaggcttcctgctagaggaccgtgccgtgtgcgtggagcgcttctcggacgat
ggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttcatggtg
ctttacttcttcggtatggccagctccatctggtgggtcattctgtccctcacttggttc
ctggcagctggcatgaagtggggccacgaggccatcgaggccaactcgcagtactttcat
ctggccgcgtgggctgtgccagcggtcaagacaatcaccattttggccatgggccaggtg
gatggtgacctactcagtggagtgtgctacgtgggcctgtctagtgtggatgcattgcgg
ggcttcgtgctggcgcccttgttcgtctacctcttcatcgggacgtccttcctgttggcc
ggctttgtgtctctctttcgcatccgcaccatcatgaagcacgacggcaccaagacagag
aagctggagaagctgatggtgcgcatcggcgtcttcagcgtgctctacacggtgccggcc
accatcgtgttggcctgctacttttatgagcaggccttccgagagcactgggaacgcacc
tggctcctgcagacttgcaagagctacgctgtgccctgccctccgggccacttctctccc
atgagccccgactttacagtcttcatgatcaagtacctgatgaccatgatcgtgggcatc
actacgggcttctggatctggtcgggcaagaccctgcagtcatggcgtcgcttctaccac
agactcagccacagcagcaagggggaaactgcggtatga

DBGET integrated database retrieval system