KEGG   Mus musculus (mouse): 14370Help
Entry
14370             CDS       T01002                                 

Gene name
Fzd8, Fz8
Definition
(RefSeq) frizzled class receptor 8
  KO
K02375  frizzled 5/8
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04150  mTOR signaling pathway
mmu04310  Wnt signaling pathway
mmu04390  Hippo signaling pathway
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04916  Melanogenesis
mmu04934  Cushing's syndrome
mmu05165  Human papillomavirus infection
mmu05166  HTLV-I infection
mmu05200  Pathways in cancer
mmu05205  Proteoglycans in cancer
mmu05217  Basal cell carcinoma
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05226  Gastric cancer
Module
mmu_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    14370 (Fzd8)
   04390 Hippo signaling pathway
    14370 (Fzd8)
   04150 mTOR signaling pathway
    14370 (Fzd8)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    14370 (Fzd8)
 Organismal Systems
  Endocrine system
   04916 Melanogenesis
    14370 (Fzd8)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    14370 (Fzd8)
   05205 Proteoglycans in cancer
    14370 (Fzd8)
   05225 Hepatocellular carcinoma
    14370 (Fzd8)
   05226 Gastric cancer
    14370 (Fzd8)
   05217 Basal cell carcinoma
    14370 (Fzd8)
   05224 Breast cancer
    14370 (Fzd8)
  Endocrine and metabolic diseases
   04934 Cushing's syndrome
    14370 (Fzd8)
  Infectious diseases
   05166 HTLV-I infection
    14370 (Fzd8)
   05165 Human papillomavirus infection
    14370 (Fzd8)
G protein-coupled receptors [BR:mmu04030]
 Others
  Wnt signaling
   Frizzled / Smoothened family
    14370 (Fzd8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz
Motif
Other DBs
NCBI-GeneID: 14370
NCBI-ProteinID: NP_032084
MGI: 108460
Ensembl: ENSMUSG00000036904
UniProt: Q61091
Structure
PDB: 

Jmol
Position
18 A1; 18 4.91 cM
AA seq 685 aa AA seqDB search
MEWGYLLEVTSLLAALAVLQRSSGAAAASAKELACQEITVPLCKGIGYNYTYMPNQFNHD
TQDEAGLEVHQFWPLVEIQCSPDLKFFLCSMYTPICLEDYKKPLPPCRSVCERAKAGCAP
LMRQYGFAWPDRMRCDRLPEQGNPDTLCMDYNRTDLTTAAPSPPRRLPPPPPPGEQPPSG
SGHSRPPGARPPHRGGSSRGSGDAAAAPPSRGGKARPPGGGAAPCEPGCQCRAPMVSVSS
ERHPLYNRVKTGQIANCALPCHNPFFSQDERAFTVFWIGLWSVLCFVSTFATVSTFLIDM
ERFKYPERPIIFLSACYLFVSVGYLVRLVAGHEKVACSGGAPGAGGAGGAGGAAAAGAGA
AGAGASSPGARGEYEELGAVEQHVRYETTGPALCTVVFLLVYFFGMASSIWWVILSLTWF
LAAGMKWGNEAIAGYSQYFHLAAWLVPSVKSIAVLALSSVDGDPVAGICYVGNQSLDNLR
GFVLAPLVIYLFIGTMFLLAGFVSLFRIRSVIKQQGGPTKTHKLEKLMIRLGLFTVLYTV
PAAVVVACLFYEQHNRPRWEATHNCPCLRDLQPDQARRPDYAVFMLKYFMCLVVGITSGV
WVWSGKTLESWRALCTRCCWASKGAAVGAGAGGSGPGGSGPGPGGGGGHGGGGGSLYSDV
STGLTWRSGTASSVSYPKQMPLSQV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggagtggggttacctgttggaagtgacctcgctcctagccgccttggcggtgctacag
cgctctagcggcgctgccgcggcttcggccaaggagctggcgtgccaagagatcacggtg
ccgttgtgcaaaggcatcggttacaactacacttacatgcccaaccagttcaaccacgac
acgcaagatgaggcgggcctagaggtgcaccagttttggccgctggtggagatacagtgc
tccccggacctcaagttctttctgtgtagcatgtacacgcccatctgcctggaggactac
aagaagcctctgccgccttgtcgctctgtgtgtgaacgcgccaaggccggctgcgcgccg
ctcatgcgccagtacggctttgcttggcctgaccgcatgcgctgcgatcggttgccggag
cagggcaacccggacactctgtgcatggactacaaccgcaccgacctcaccacggccgcg
cccagcccaccgcgccgcctgcctccgccgcctcctcccggcgagcagccgccctctggc
agcggccacagccgcccgccaggggccaggcccccacatcgtggcggcagcagtaggggc
agcggggacgcggcggctgcgcccccttcgcgcggcgggaaggcgaggccccctggtggc
ggcgctgctccctgcgagccggggtgccagtgccgcgcgcccatggtgagcgtgtccagc
gaacgccacccgctctacaaccgcgtcaagaccggccagatcgccaactgtgcgctgccc
tgccacaaccccttctttagccaggatgagcgcgccttcaccgtcttctggatcggcctg
tggtcggtgctctgcttcgtctccaccttcgccactgtctctaccttcctcatcgatatg
gagcgctttaagtacccggaacggcccatcatattcctctccgcctgttacctcttcgtg
tctgtcgggtacctggtgcgcctggtggcaggacatgagaaagtggcctgcagcggcggc
gctccgggtgctggcggagctgggggtgcgggcggcgcggcggcggctggcgcaggggca
gcgggagcgggggcgagcagcccgggcgcgcgcggcgagtacgaggagctgggtgcagtc
gagcagcatgttcgctatgaaaccactggccccgcgctgtgcacggtggtctttctcctt
gtctacttttttggcatggccagctccatctggtgggtaatcctgtcgctcacgtggttc
ttggcagctggcatgaagtggggtaatgaggccatagcaggctactcgcagtacttccac
ctggccgcgtggcttgtgcccagcgtcaagtccatcgcggtgctggcgctcagctccgta
gacggcgacccggtggcgggcatctgctacgtgggcaaccagagccttgacaacctacgc
ggctttgtgctggcgccactggttatctacctcttcattgggactatgtttctgttagct
ggcttcgtgtcgctgttccgaatccgttcagtcatcaagcagcaaggaggcccaactaag
acacacaagctagaaaaactcatgatccgcttgggcctcttcaccgtgctctacacggtg
cccgctgccgtcgttgtcgcctgccttttctatgagcagcacaaccgaccgcgctgggag
gccacgcacaactgcccatgccttcgggacctgcaaccggaccaggctcgcaggcccgat
tacgcggtcttcatgctcaagtacttcatgtgcctagtagtgggcatcacatcgggcgtg
tgggtctggtccggcaagactctggagtcctggcgcgcgttgtgcactaggtgctgctgg
gccagcaagggcgctgcagtaggcgcgggcgctggaggcagcggccctgggggcagtgga
cccgggcccggcggaggtgggggacacggcggaggcgggggatccctctacagcgacgtc
agtaccggcctgacgtggcggtctggcacggccagctctgtatcttaccctaagcaaatg
ccattgtcccaggtctga

DBGET integrated database retrieval system