KEGG   Mus musculus (mouse): 14394Help
Entry
14394             CDS       T01002                                 

Gene name
Gabra1, Gabra-1
Definition
(RefSeq) gamma-aminobutyric acid (GABA) A receptor, subunit alpha 1
  KO
K05175  
gamma-aminobutyric acid receptor subunit alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Retrograde endocannabinoid signaling
GABAergic synapse
Taste transduction
Morphine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14394 (Gabra1)
 Organismal Systems
  Nervous system
   04727 GABAergic synapse
    14394 (Gabra1)
   04723 Retrograde endocannabinoid signaling
    14394 (Gabra1)
  Sensory system
   04742 Taste transduction
    14394 (Gabra1)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    14394 (Gabra1)
   05033 Nicotine addiction
    14394 (Gabra1)
Ion channels [BR:mmu04040]
 Cys-loop superfamily
  GABA-A
   14394 (Gabra1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 A5; 11 24.97 cM
AA seq 455 aa AA seqDB search
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaagtcggggtctctctgactatctttgggcctggaccctcattctgagcaca
ctgtcgggaagaagctatggacagccctcccaagatgaacttaaagacaacaccactgtc
ttcacaagaattttggaccgactgctggacggttatgacaatcgtctgagaccaggtttg
ggagagcgtgtaactgaagtgaagaccgacattttcgtcaccagtttcggaccagtttca
gaccacgatatggagtatacaatagatgtgtttttccgtcaaagttggaaggatgaaaga
ttaaaattcaaaggacccatgacagtgctccggctaaacaaccttatggccagtaaaatc
tggactccagatacatttttccacaatggaaagaagtctgtggcccacaacatgaccatg
cctaataagctcctgcgtatcacagaggatggcactctgctgtacaccatgaggttgacc
gtgagagctgaatgcccaatgcacttggaagacttccctatggatgcccatgcctgccca
ctaaaattcggaagctatgcttatacaagagcagaagttgtctatgagtggaccagagag
ccagcccgttcagtggttgtagcagaagatgggtcacgtttaaaccagtatgaccttctt
ggacaaacagttgactctggaattgttcagtccagtactggagaatatgtggttatgacg
actcacttccacttgaagagaaaaattggctactttgttattcaaacatatctgccgtgc
ataatgacagttattctctcccaagtctccttctggctcaacagagagtcagtaccagca
agaactgtctttggagtgacgactgttctgactatgacaaccttgagtatcagtgccaga
aattccctcccgaaggtggcttatgcaacagctatggactggtttattgcagtatgctat
gcctttgttttctcagctctgattgagtttgccacagtaaactatttcaccaagagaggg
tatgcgtgggatggcaaaagcgtggttccagaaaagccaaagaaagtaaaggatcctctc
attaagaaaaacaacacatatgctcctacagcaaccagctatacccctaacttagccagg
ggtgaccccggcttggcaactattgctaaaagtgcgaccatagaaccgaaagaagtcaag
cctgagacaaaaccaccagaacccaagaaaacctttaacagcgtcagcaaaatcgaccga
ctgtcaagaatagcctttccgctgctatttggaatctttaacttagtctattgggccacg
tatttaaacagagagcctcagctaaaagcccccacaccccatcaatag

DBGET integrated database retrieval system