KEGG   Mus musculus (mouse): 14420Help
Entry
14420             CDS       T01002                                 

Gene name
Galc, 2310068B06Rik, A930008M05Rik, AW212969, AW413532, Gacy, twi, twitcher
Definition
galactosylceramidase (EC:3.2.1.46)
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
mmu  Mus musculus (mouse)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    14420 (Galc)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    14420 (Galc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     14420 (Galc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
12 E; 12 49.83 cM
AA seq 684 aa AA seqDB search
MANSQPKASQQRQAKVMTAAAGSASRVAVPLLLCALLVPGGAYVLDDSDGLGREFDGIGA
VSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYE
LDENYFRGYEWWLMKEAKKRNPDIILMGLPWSFPGWLGKGFSWPYVNLQLTAYYVVRWIL
GAKHYHDLDIDYIGIWNERPFDANYIKELRKMLDYQGLQRVRIIASDNLWEPISSSLLLD
QELWKVVDVIGAHYPGTYTVWNAKMSGKKLWSSEDFSTINSNVGAGCWSRILNQNYINGN
MTSTIAWNLVASYYEELPYGRSGLMTAQEPWSGHYVVASPIWVSAHTTQFTQPGWYYLKT
VGHLEKGGSYVALTDGLGNLTIIIETMSHQHSMCIRPYLPYYNVSHQLATFTLKGSLREI
QELQVWYTKLGTPQQRLHFKQLDTLWLLDGSGSFTLELEEDEIFTLTTLTTGRKGSYPPP
PSSKPFPTNYKDDFNVEYPLFSEAPNFADQTGVFEYYMNNEDREHRFTLRQVLNQRPITW
AADASSTISVIGDHHWTNMTVQCDVYIETPRSGGVFIAGRVNKGGILIRSATGVFFWIFA
NGSYRVTADLGGWITYASGHADVTAKRWYTLTLGIKGYFAFGMLNGTILWKNVRVKYPGH
GWAAIGTHTFEFAQFDNFRVEAAR
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggctaacagccaacctaaggcttcccagcaacgccaagcaaaagtcatgaccgccgcc
gcgggctcggcgagccgtgttgcggtgcccttattgttgtgtgcgctgctagtgcccggt
ggcgcctacgtgctagacgactccgacgggctgggccgggagttcgatggcatcggcgca
gtcagcggcggcggggcaacctcccggcttctagtaaattacccagagccctatcgttct
gaaatactggattatctatttaagccaaactttggtgcctctttgcatattctaaaagtg
gagataggtggtgatggacaaacaacagatggcactgaaccctcgcacatgcactatgag
ctagatgagaattatttccgaggctatgagtggtggctaatgaaggaagctaagaagcgg
aacccagatattatacttatggggttgccatggtcattccctggatggctgggcaaaggc
ttcagctggccttatgtaaatcttcagctcactgcctactatgttgtaagatggattttg
ggtgccaagcattatcatgacctggacattgattatattgggatttggaatgaaaggccg
tttgacgccaactatataaaggaattaagaaaaatgctggattatcaaggtctccagcga
gtgagaatcatagcgagcgataatctctgggagccgatttcctcttccttgctgctggac
caggaactctggaaggtggttgatgttataggagctcactatcctggaacctacacagtg
tggaatgcaaagatgtcagggaagaagctgtggtcatctgaagattttagcactatcaac
agtaatgttggcgcaggctgttggagtcgcatattgaaccagaattacatcaatggcaat
atgacctccacaattgcttggaatttggtggctagttactatgaagagttgccttatgga
cgaagtgggttgatgacggcccaggagccatggagtggacattatgtcgtagcatctcct
atctgggtatcagctcacacaacccagtttactcaaccaggctggtattacctgaagaca
gtgggccatctagagaaaggaggaagttatgttgctctgactgatggcttgggaaacctc
accatcatcattgaaactatgagtcatcaacattctatgtgtatacggccatatctgcca
tattataatgtctcacatcagctggctaccttcactctaaagggatctttgagagaaata
caagagctgcaggtgtggtataccaagctgggaactccgcagcagagacttcattttaaa
caactggatactctatggctccttgacggcagcggcagtttcacactggaactggaggag
gacgagatatttacgctcaccactctgaccacaggtcgcaaaggcagctaccctccccct
cccagctcgaagcccttcccaaccaactacaaggatgatttcaatgttgagtacccactt
tttagtgaagctccgaattttgctgatcagactggcgtgtttgagtactacatgaataat
gaagaccgtgagcaccgcttcacgctgcgccaagttctcaaccaacgacctattacctgg
gctgcagacgcttccagcacaatcagtgttataggcgatcaccactggaccaacatgact
gtgcagtgcgatgtttatatagagacccctcggagcggcggcgtattcattgctggaaga
gtgaataaaggtggaatcttgattagaagtgctacaggagtctttttctggatttttgca
aatggctcttacagagtcacagctgacctgggtggatggataacgtatgcttcaggacat
gcggacgttacagctaaacgatggtacacactcaccttaggcattaagggttatttcgcc
tttggtatgttgaacggcacgatcctatggaaaaacgtccgtgtgaaatacccagggcat
ggctgggctgcgatcggaacacacaccttcgagtttgcgcagtttgacaactttcgcgtg
gaagctgctcgctag

DBGET integrated database retrieval system