KEGG   Mus musculus (mouse): 14428Help
Entry
14428             CDS       T01002                                 

Gene name
Galr2, mGalR
Definition
(RefSeq) galanin receptor 2
  KO
K04231  
galanin receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14428 (Galr2)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Galanin [OT]
    14428 (Galr2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 E2; 11 81.1 cM
AA seq 371 aa AA seqDB search
MNGSDSQGAEDSSQEGGGGWQPEAVLVPLFFALIFLVGAVGNALVLAVLLRGGQAVSTTN
LFILNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSL
DRYLAIRYPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYSQSQLANLTVCHPAWSA
PRRRAMDLCTFVFSYLLPVLVLSLTYARTLHYLWRTVDPVAAGSGSQRAKRKVTRMIVIV
AVLFCLCWMPHHALILCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRK
GFRKICAGLLRRAPRRASGRVCILAPGNHSGGMLEPESTDLTQVSEAAGPLVPAPALPNC
TTLSRTLDPAC
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaatggctcggacagccagggggcggaggactcgagccaggaaggtggcggcggctgg
cagcccgaggcggtcctcgtacccctatttttcgcgctcatcttcctcgtgggcgctgtg
ggcaacgcgctggtgctggcggtgctgctgcgcggcggccaggcggtcagcaccacgaac
ctattcatcctcaacctgggtgtggccgacctgtgtttcatcctgtgctgcgtgcctttc
caggccaccatctataccctggacgattgggtgtttggctcactgctctgcaaggccgtt
catttcctcatcttcctcactatgcacgccagcagcttcacgctggccgctgtctcgctg
gacaggtatctggccatccgctacccgctgcactcccgagagttgcgcacacctcgaaac
gcgctggcggccatcgggctcatctgggggctagcactgctcttctccgggccctacctg
agctactacagtcagtcgcagctggccaatctgacggtgtgccacccagcgtggagcgca
ccacgacgtcgcgccatggacctctgcacttttgtctttagctacctgttgccagtgctg
gtgctcagcctgacctatgcgcgcaccctgcactacctctggcgcacagttgacccagta
gctgcaggctcaggttcccagcgcgccaagcgcaaggtgacacggatgatcgtcatcgtg
gcggtactcttctgcctctgttggatgccccaccacgcgcttatcctctgcgtgtggttt
ggtcgctttccgctcacgcgtgccacttacgccctgcgcatcctttcacatctagtatct
tatgccaactcgtgtgtcaaccccatcgtttatgctctggtctccaagcatttccgcaaa
ggtttccgcaaaatctgcgcgggcctgctacgccgtgccccgaggagagcttcaggccga
gtgtgcatcctggcgcctggaaaccatagtggtggcatgctggaacctgagtccacagac
ctgacacaggtgagcgaggcagccgggcccctcgtccccgcacccgcacttcccaactgc
acaaccttgagtagaaccctcgatccagcctgttaa

DBGET integrated database retrieval system