KEGG   Mus musculus (mouse): 14430Help
Entry
14430             CDS       T01002                                 

Gene name
Galt, AW553376
Definition
(RefSeq) galactose-1-phosphate uridyl transferase
  KO
K00965  UDPglucose--hexose-1-phosphate uridylyltransferase [EC:2.7.7.12]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00052  Galactose metabolism
mmu00520  Amino sugar and nucleotide sugar metabolism
mmu01100  Metabolic pathways
mmu04917  Prolactin signaling pathway
Module
mmu_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
mmu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    14430 (Galt)
   00520 Amino sugar and nucleotide sugar metabolism
    14430 (Galt)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    14430 (Galt)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.12  UDP-glucose---hexose-1-phosphate uridylyltransferase
     14430 (Galt)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GalP_UDP_tr_C GalP_UDP_transf HIT
Motif
Other DBs
NCBI-GeneID: 14430
NCBI-ProteinID: NP_057867
MGI: 95638
Ensembl: ENSMUSG00000036073
Vega: OTTMUSG00000006678
UniProt: Q03249 A2AMS3
Position
4 A5; 4 22.07 cM
AA seq 360 aa AA seqDB search
MAATFRASEHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGAT
RANGEVNPHYDGTFLFDNDFPALQPDAPDPGPSDHPLFRAEAARGVCKVMCFHPWSDVTL
PLMSVPEIRAVIDAWASVTEELGAQYPWVQIFENKGAMMGCSNPHPHCQVWASSFLPDIA
QREERSQQTYHSQHGKPLLLEYGHQELLRKERLVLTSEHWIVLVPFWAVWPFQTLLLPRR
HVRRLPELNPAERDDLASIMKKLLTKYDNLFETSFPYSMGWHGAPTGLKTGATCDHWQLH
AHYYPPLLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYCLAQKDKETAAIA
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgaccttccgggcgagcgaacaccagcatattcgctacaacccgctccaggac
gagtgggtgttagtgtcggctcatcgcatgaagcggccctggcaaggacaagtggagccc
cagcttctgaagacagtgccccgccacgacccactcaaccctctgtgtcccggggccaca
cgagctaatggggaggtgaatccccactatgatggtacctttctgtttgacaatgacttc
ccggctctgcagcccgatgctccggatccaggacccagtgaccaccctctcttccgagca
gaggccgccagaggagtttgtaaggtcatgtgcttccacccctggtcggatgtgacgctg
ccactcatgtctgtccctgagatccgagctgtcatcgatgcatgggcctcagtcacagag
gagctgggtgcccagtacccttgggtgcagatctttgaaaataaaggagccatgatgggc
tgttctaacccccatccccactgccaggtttgggctagcagcttcctgccagatatcgcc
cagcgtgaagagcgatcccagcagacctatcacagccagcatggaaaacctttgttattg
gaatatggtcaccaagagctcctcaggaaggaacgtctggtcctaaccagtgagcactgg
atagttctggtccccttctgggcagtgtggcctttccagacacttctgctgccccggcgg
cacgtgcggcggctacctgagctgaaccccgctgagcgtgatgatctcgcctccatcatg
aagaagctcttgaccaagtacgacaatctatttgagacatcctttccctactccatgggc
tggcatggggctcccacgggattaaagactggagccacctgtgaccactggcagctccac
gcccactactaccccccacttctgcgatccgcaactgtccggaagttcatggttggctat
gaaatgcttgcccaggcccagcgtgacctcactcccgaacaggccgcagaaagattaagg
gcgcttcccgaggtacactattgcctggcgcagaaagacaaggaaacggcagccattgct
tga

DBGET integrated database retrieval system