KEGG   Mus musculus (mouse): 14431Help
Entry
14431             CDS       T01002                                 

Gene name
Gamt, AA571402, Spintz1
Definition
guanidinoacetate methyltransferase (EC:2.1.1.2)
Orthology
K00542  
guanidinoacetate N-methyltransferase [EC:2.1.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Metabolic pathways
Module
Creatine pathway
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mmu00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mmu00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
10 C1; 10 39.72 cM
AA seq 236 aa AA seqDB search
MSSSAASPLFAPGEDCGPAWRAAPAAYDASDTHLQILGKPVMERWETPYMHALAAAAASR
GGRVLEVGFGMAIAASRVQQAPIEEHWIIECNDGVFQRLQDWALRQPHKVVPLKGLWEEV
APTLPDGHFDGILYDTYPLSEEAWHTHQFNFIKNHAFRLLKTGGVLTYCNLTSWGELMKS
KYTDITTMFEETQVPALQEAGFLKENICTEVMALVPPADCRYYAFPQMITPLVTKH
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgagctcttctgcagctagcccgctcttcgcgcccggcgaggactgcggccccgcgtgg
cgcgcggcccccgcggcctatgacgcgtctgacacgcacctgcaaatcctgggcaagcca
gtgatggagcgttgggagaccccctatatgcatgcgctagcggcggctgctgcctccaga
gggggccgggtcttggaagtgggcttcggtatggccattgcagcctccagggtgcaacag
gcccccatagaggaacactggattattgagtgcaatgatggggtcttccagcgtctacaa
gactgggccctgcggcagccacataaggttgttcccttgaaaggcctgtgggaggaggtg
gcacctaccctgcctgacggtcactttgatgggattctatatgacacgtacccgctgtct
gaagaggcctggcacactcaccagttcaactttattaagaatcatgccttccgcttgctg
aagaccgggggcgtcctcacctactgcaacctcacgtcctggggggagctcatgaagtcc
aaatacacagacatcaccaccatgtttgaggagacgcaggtgcctgcactgcaggaagct
ggcttcctgaaagaaaacatctgcacagaggtgatggcactggtgcccccagccgactgc
cgctactatgccttccctcagatgatcacacccctggtcaccaagcactga

DBGET integrated database retrieval system