KEGG   Mus musculus (mouse): 14433Help
Entry
14433             CDS       T01002                                 

Gene name
Gapdh, Gapd
Definition
(RefSeq) glyceraldehyde-3-phosphate dehydrogenase (EC:1.2.1.12)
  KO
K00134  
glyceraldehyde 3-phosphate dehydrogenase [EC:1.2.1.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
HIF-1 signaling pathway
Alzheimer's disease
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    14433 (Gapdh)
   01230 Biosynthesis of amino acids
    14433 (Gapdh)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    14433 (Gapdh)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    14433 (Gapdh)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    14433 (Gapdh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.12  glyceraldehyde-3-phosphate dehydrogenase (phosphorylating)
     14433 (Gapdh)
Exosome [BR:mmu04147]
 Exosomal proteins
  Proteins found in most exosomes
   14433 (Gapdh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 F2; 6 59.32 cM
AA seq 333 aa AA seqDB search
MVKVGVNGFGRIGRLVTRAAICSGKVEIVAINDPFIDLNYMVYMFQYDSTHGKFNGTVKA
ENGKLVINGKPITIFQERDPTNIKWGEAGAEYVVESTGVFTTMEKAGAHLKGGAKRVIIS
APSADAPMFVMGVNHEKYDNSLKIVSNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAIT
ATQKTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSV
VDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEDQVVSCDFNSNSHSSTFDAGAGIA
LNDNFVKLISWYDNEYGYSNRVVDLMAYMASKE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaggtcggtgtgaacggatttggccgtattgggcgcctggtcaccagggctgcc
atttgcagtggcaaagtggagattgttgccatcaacgaccccttcattgacctcaactac
atggtctacatgttccagtatgactccactcacggcaaattcaacggcacagtcaaggcc
gagaatgggaagcttgtcatcaacgggaagcccatcaccatcttccaggagcgagacccc
actaacatcaaatggggtgaggccggtgctgagtatgtcgtggagtctactggtgtcttc
accaccatggagaaggccggggcccacttgaagggtggagccaaaagggtcatcatctcc
gccccttctgccgatgcccccatgtttgtgatgggtgtgaaccacgagaaatatgacaac
tcactcaagattgtcagcaatgcatcctgcaccaccaactgcttagcccccctggccaag
gtcatccatgacaactttggcattgtggaagggctcatgaccacagtccatgccatcact
gccacccagaagactgtggatggcccctctggaaagctgtggcgtgatggccgtggggct
gcccagaacatcatccctgcatccactggtgctgccaaggctgtgggcaaggtcatccca
gagctgaacgggaagctcactggcatggccttccgtgttcctacccccaatgtgtccgtc
gtggatctgacgtgccgcctggagaaacctgccaagtatgatgacatcaagaaggtggtg
aagcaggcatctgagggcccactgaagggcatcttgggctacactgaggaccaggttgtc
tcctgcgacttcaacagcaactcccactcttccaccttcgatgccggggctggcattgct
ctcaatgacaactttgtcaagctcatttcctggtatgacaatgaatacggctacagcaac
agggtggtggacctcatggcctacatggcctccaaggagtaa

DBGET integrated database retrieval system