KEGG   Mus musculus (mouse): 14479Help
Entry
14479             CDS       T01002                                 

Gene name
Usp15, 4921514G19Rik, AI327321, E430033I05Rik, Gcap18, mKIAA0529
Definition
ubiquitin specific peptidase 15 (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     14479 (Usp15)
Peptidases [BR:mmu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   14479 (Usp15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 D3
AA seq 981 aa AA seqDB search
MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNV
YPGPIDNSGLLKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQ
GMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFNIPDEKEARLW
NKYMSNTFEPLNKPDSTIQDAGLYQGQVLVIEQKNEDGTWPRGPSTPKSPGASNFSTLPK
ISPSSLSNNYNNINNRNVKNSNYCLPSYTAYKNYDYSEPGRNNEQPGLCGLSNLGNTCFM
NSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMWSGKFSYVTPR
AFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERSLEVYL
VRMDPLAKPMQYKVIVPKIGNILDLCTALSALSGVPADKMIVTDIYNHRFHRIFAVDENL
SSIMERDDIYVFEININRAEDTEHVVIPVCLREKFRHSSYTHHTGSSLFGQPFLMAIPRN
NTEDKLYNLLLLRMCRYVKMSTETEETDGHLRCCEDQNINGNGPNGLHEEGSPSEMETDE
PDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEETCKGQLTGHKKRLFTFQFNNLG
NNDINYIKDDTSHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDFEKHESVEYKP
PKRPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY
SRYMRDKLDTLVDFPISDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKD
DGKWYYFDDSSVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLE
SDEDSNDNDNDLENENCMHTN
NT seq 2946 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggcggagcggcggacctggacacccagcgttctgacatcgcgacgctgctc
aaaacctcgctccggaaaggggacacctggtatctagtagatagtcggtggttcaaacag
tggaaaaaatatgttggctttgacagctgggacaaataccagatgggagatcaaaatgtc
tatcctggacccatcgataactctggacttctcaaagatggcgacgcgcagtcacttaag
gagcaccttattgatgagttggattacatactcttgccaactgagggctggaataaactt
gtcagctggtacacactgatggagggccaggagccaatagcaagaaaggtggtagaacag
ggtatgtttgtaaagcactgcaaagtagaagtctacctcacagaactgaagctctgtgag
aacgggaacatgaacaatgttgtaactcggaggtttagcaaagctgacacaatagatacg
attgagaaggaaataagaaaaatcttcaatattccagatgagaaggaggccagactgtgg
aacaagtatatgagcaacacatttgaaccactgaataagccagacagcaccatccaggat
gccggcctataccaaggacaggtgttagtgatagagcaaaaaaatgaagatggaacgtgg
cccaggggtccctctactcctaagtccccaggtgcatccaatttttcaactttaccaaag
atctctccttcatctctatcaaataattataacaacatcaacaacagaaatgtgaaaaac
tcaaattattgtctcccgtcatatactgcttataagaactatgattattcagaacctgga
agaaacaatgaacagccaggcctgtgtggcttaagtaacttgggaaatacgtgtttcatg
aactcagccattcagtgtttgagcaacacacctccacttactgaatatttcctcaatgat
aagtaccaagaagagctgaattttgacaatcccttaggaatgagaggtgaaatagctaaa
tcatacgctgaactcatcaagcagatgtggtctggaaagtttagctacgtcactccaaga
gcattcaagacacaggtagggcgcttcgcacctcagttctctggatatcaacagcaggac
tgccaagaactactggctttcctgttggatggactgcacgaggacctgaatagaattagg
aaaaaaccctatatccagttaaaagatgctgatggcaggccagacaaggtggttgctgaa
gaagcctgggagaaccatttaaagcgaaatgattccatcatagtagacatattccatggc
cttttcaagtctacgttagtgtgtcctgagtgtgctaagatctcggtgacctttgaccct
ttctgttacttgactcttccattgcctatgaaaaaagaacgtagcttggaagtttattta
gttagaatggatccacttgctaaacctatgcaatacaaagttattgtgcccaaaattgga
aatatactagatctttgtacagcgctgtctgctttgtcgggagtacctgcagataagatg
atagtcactgacatatacaatcatagatttcacaggatatttgccgtggatgaaaacctg
agtagtattatggagcgggatgatatttacgtgtttgaaattaacatcaacagggcagaa
gacacagagcatgtagttatccctgtctgcctaagagaaaaattcagacactcaagttac
actcaccacactggctcttcactgttcggccagccttttcttatggctataccacgaaac
aatactgaagataaactctataatcttctactcttgagaatgtgccggtatgtcaaaatg
tctactgaaactgaggaaacagatggacacctacgttgctgtgaggaccagaatattaat
gggaatgggccaaatggcctacatgaagagggttcaccaagtgagatggaaaccgacgag
ccagatgacgagtccagccaggatcaagagcttccctcagagaacgagaacagtcagtct
gaagattcagtcggaggagataacgattctgaaaatggattgtgcactgaagaaacatgc
aaaggtcaacttacgggacacaaaaagcgcttgtttacattccagttcaacaacttaggc
aacaatgacatcaactacatcaaagacgacaccagtcacatccgattcgatgacaggcag
cttcggctggacgaaagatcttttctcgctttggactgggaccctgacttgaagaagaga
tactttgatgagaatgctgcagaggattttgaaaaacatgaaagtgtggaatacaaacct
ccaaaaaggccctttgtgaagttaaaagactgcattgagctcttcaccaccaaggagaag
ctgggtgctgaggacccctggtattgtccaaattgtaaagagcatcagcaagccacaaag
aaattagatctgtggtccctgcctccagttcttgtggtgcatctcaagagattctcctat
agtcgctacatgagagacaagctagatacattagtcgattttcccatcagtgacttggat
atgtcagaattcctaattaacccaaatgcaggtccttgccgctataatttgattgctgtt
tccaaccactatggagggatgggaggaggacattatactgcttttgcaaaaaacaaagat
gatgggaagtggtactatttcgatgacagtagcgtctccactgcatctgaagaccaaatc
gtgtccaaggcagcgtacgtgctcttctaccagagacaggacactttcagtgggactggc
ttcttccctcttgaccgagaaactaaaggtgcttcagctgccacaggtatccccctggaa
agtgacgaagacagcaatgataatgacaatgacctagaaaatgaaaactgtatgcacact
aattaa

DBGET integrated database retrieval system