KEGG   Mus musculus (mouse): 14489Help
Entry
14489             CDS       T01002                                 

Gene name
Mtpn, 5033418D15Rik, Gcdp, V1
Definition
(RefSeq) myotrophin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
6; 6 B1
AA seq 118 aa AA seqDB search
MCDKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGAD
INAPDKHHITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATDNQAIKALLQ
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgacaaggagttcatgtgggccctgaaaaacggagacttggatgaggtgaaggac
tatgtggctaagggagaagatgtcaaccggacactagagggtggaaggaagcctcttcat
tatgctgcagattgtggacagcttgaaatcctggaatttctgctgctgaaaggagcagat
attaatgctccagataaacatcatattacccctcttctgtctgctgtctatgagggtcat
gtttcctgcgtgaaattgcttctgtcaaagggtgctgataagactgtgaaaggcccagat
ggactgaccgcccttgaagccactgacaaccaggcaatcaaagctcttctccagtga

DBGET integrated database retrieval system