KEGG   Mus musculus (mouse): 14527Help
Entry
14527             CDS       T01002                                 

Gene name
Gcgr, GR
Definition
(RefSeq) glucagon receptor
  KO
K04583  
glucagon receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14527 (Gcgr)
 Organismal Systems
  Endocrine system
   04922 Glucagon signaling pathway
    14527 (Gcgr)
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Pancreatic peptide
   Glucagon
    14527 (Gcgr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E2
AA seq 485 aa AA seqDB search
MPLTQLHCPHLLLLLLVLSCLPEAPSAQVMDFLFEKWKLYSDQCHHNLSLLPPPTELVCN
RTFDKYSCWPDTPPNTTANISCPWYLPWYHKVQHRLVFKRCGPDGQWVRGPRGQPWRNAS
QCQLDDEEIEVQKGVAKMYSSQQVMYTVGYSLSLGALLLALVILLGLRKLHCTRNYIHGN
LFASFVLKAGSVLVIDWLLKTRYSQKIGDDLSVSVWLSDGAMAGCRVATVIMQYGIIANY
CWLLVEGVYLYSLLSLATFSERSFFSLYLGIGWGAPLLFVIPWVVVKCLFENVQCWTSND
NMGFWWILRIPVFLALLINFFIFVHIIHLLVAKLRAHQMHYADYKFRLARSTLTLIPLLG
VHEVVFAFVTDEHAQGTLRSTKLFFDLFLSSFQGLLVAVLYCFLNKEVQAELMRRWRQWQ
EGKALQEERLASSHGSHMAPAGPCHGDPCEKLQLMSAGSSSGTGCVPSMETSLASSLPRL
ADSPT
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcacccagctccactgtccccacctgctgctgctgctgttggtgctgtcatgt
ctgccagaggcaccctctgcccaggtaatggactttttgtttgagaagtggaagctctat
agtgaccaatgccaccacaacctaagcctgctgcccccacctactgagctggtctgtaac
agaaccttcgacaagtactcctgctggcctgacacccctcccaacaccactgccaacatt
tcctgcccctggtacctaccttggtaccacaaagtgcagcaccgcctagtgttcaagagg
tgtgggcccgatgggcagtgggttcgagggccacgggggcagccgtggcgcaacgcctcc
caatgtcagttggatgatgaagagatcgaggtccagaagggggtggccaagatgtatagc
agccagcaggtgatgtacaccgtgggctacagtctgtccctgggggccttgctccttgcg
ctggtcatcctgctgggcctcaggaagctgcactgcacccgaaactacatccatgggaac
ctgtttgcgtcctttgtgctcaaggctggctctgtgttggtcatcgattggctgctgaag
acacggtacagccagaagattggcgatgacctcagtgtgagcgtctggctcagtgacggg
gcgatggccggctgcagagtggccacagtgatcatgcagtacggcatcatagccaactat
tgctggttgctggtagagggcgtgtacctgtacagcctgctgagccttgccaccttctct
gagaggagcttcttttccctctacctgggcattggctggggtgcgcccctgctgtttgtc
atcccctgggtggtggtcaagtgtctgtttgagaatgttcagtgctggaccagcaatgac
aacatgggattctggtggatcctgcgtattcctgtcttcctggccttactgatcaatttt
ttcatctttgtccacatcattcaccttcttgtggccaagctgcgtgcccatcagatgcac
tatgctgactataagttccggctggccaggtccacgctgaccctcatccctctgctgggg
gtccacgaggtggtctttgcctttgtgactgacgagcatgcccaaggcaccctgcgctcc
accaagctcttttttgacctgttcctcagctccttccagggtctgctggtggctgttctc
tactgtttcctcaacaaggaggtgcaggcagagctgatgcggcgttggaggcaatggcaa
gaaggcaaagctcttcaggaggaaaggttggccagcagccatggcagccacatggcccca
gcagggccttgtcatggtgatccctgtgagaaacttcagcttatgagtgcaggcagcagc
agtgggactggctgtgtgccctctatggagacctcgctggccagtagtctcccaaggttg
gctgacagccccacctga

DBGET integrated database retrieval system