KEGG   Mus musculus (mouse): 14528Help
Entry
14528             CDS       T01002                                 

Gene name
Gch1, GTP-CH, GTPCH, Gch
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mmu  Mus musculus (mouse)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    14528 (Gch1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     14528 (Gch1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
14 C2-3; 14 24.6 cM
AA seq 241 aa AA seqDB search
MEKPRGVRCTNGFSERELPRPGASPPAEKSRPPEAKGAQPADAWKAGRHRSEEENQVNLP
KLAAAYSSILLSLGEDPQRQGLLKTPWRAATAMQYFTKGYQETISDVLNDAIFDEDHDEM
VIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQI
AVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLIR
S
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggagaagccgcggggagtcaggtgcaccaatgggttctccgagcgggagctgccgcgg
cccggggccagcccgcctgccgagaagtcccggccgcccgaggccaagggcgcacagccg
gccgacgcctggaaggcagggcggcaccgcagcgaggaggaaaaccaggtgaacctcccc
aaactggcggccgcttactcgtccattctgctctcgctgggcgaggacccccagcggcag
gggctgctcaagacgccctggagggcggccaccgccatgcagtacttcaccaagggatac
caggagaccatctcagatgtcctgaatgatgctatatttgatgaagatcatgacgagatg
gtgattgtgaaggacatagatatgttctccatgtgtgagcatcaccttgttccatttgta
ggaagggtccatattggctatcttcctaacaagcaagtccttggtctcagtaaacttgcc
aggattgtagaaatctacagtagacgactacaagttcaagagcgcctcaccaaacagatt
gcggtggccatcacagaagccttgcagcctgctggcgttggagtagtgattgaagcgaca
cacatgtgcatggtaatgcgaggcgtgcagaaaatgaacagcaagactgtcactagcacc
atgctgggcgtgttccgggaagaccccaagactcgggaggagttcctcacactaatcagg
agctga

DBGET integrated database retrieval system