KEGG   Mus musculus (mouse): 14534Help
Entry
14534             CDS       T01002                                 

Gene name
Kat2a, 1110051E14Rik, AW212720, Gcn5, Gcn5l2, mmGCN5
Definition
(RefSeq) K(lysine) acetyltransferase 2A (EC:2.3.1.48)
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Notch signaling pathway
Thyroid hormone signaling pathway
HTLV-I infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    14534 (Kat2a)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    14534 (Kat2a)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    14534 (Kat2a)
  Infectious diseases
   05166 HTLV-I infection
    14534 (Kat2a)
Enzymes [BR:mmu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     14534 (Kat2a)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     14534 (Kat2a)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    14534 (Kat2a)
   HAT complexes
    PCAF complex
     14534 (Kat2a)
    STAGA complex
     14534 (Kat2a)
    TFTC complex
     14534 (Kat2a)
    SAGA complex
     14534 (Kat2a)
    SLIK complex
     14534 (Kat2a)
    ADA-HAT complex
     14534 (Kat2a)
    HAT-A2 complex
     14534 (Kat2a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 D; 11 63.53 cM
AA seq 830 aa AA seqDB search
MAEPSQAPNPVPAAQPRPLHSPAPAPTSTPAPSPASASTPAPTPAPAPAPAAAPAGSTGS
GGAGVGSGGDPARPGLSQQQRASQRKAQVRGLPRAKKLEKLGVFSACKANETCKCNGWKN
PKPPTAPRMDLQQPAANLSELCRSCEHPLADHVSHLENVSEDEINRLLGMVVDVENLFMS
VHKEEDTDTKQVYFYLFKLLRKCILQMTRPVVEGSLGSPPFEKPNIEQGVLNFVQYKFSH
LAPRERQTMFELSKMFLLCLNYWKLETPAQFRQRSQSEDVATYKVNYTRWLCYCHVPQSC
DSLPRYETTHVFGRSLLRSIFTVTRRQLLEKFRVEKDKLVPEKRTLILTHFPKFLSMLEE
EIYGANSPIWESGFTMPPSEGTQLVPRPATVSATVVPSFSPSMGGGSNSSLSLDSAGTEP
MPAGEKRKLPENLTLEDAKRLRVMGDIPMELVNEVMLTITDPAAMLGPETSLLSANAARD
ETARLEERRGIIEFHVIGNSLTPKANRRVLLWLVGLQNVFSHQLPRMPKEYIARLVFDPK
HKTLALIKDGRVIGGICFRMFPTQGFTEIVFCAVTSNEQVKGYGTHLMNHLKEYHIKHSI
LYFLTYADEYAIGYFKKQGFSKDIKVPKSRYLGYIKDYEGATLMECELNPRIPYTELSHI
IKKQKEIIKKLIERKQAQIRKVYPGLSCFKEGVRQIPVESVPGIRETGWKPLGKEKGKEL
KDPDQLYTTLKNLLAQIKSHPSAWPFMEPVKKSEAPDYYEVIRFPIDLKTMTERLRSRYY
VTRKLFVADLQRVIANCREYNPPDSEYCRCASALEKFFYFKLKEGGLIDK
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaccttcccaggccccaaacccggtcccggcagcgcagccccggccccttcac
tccccagcccctgccccaacttcgactcctgcgcccagtccggcttcagcctccactccg
gctccgactccggcaccagcccctgccccagctgcagccccagctgggagcacagggagt
gggggcgccggggtaggaagtgggggggatccggctcgacctggcctgagccagcagcag
cgcgctagccagaggaaggcgcaagtccggggtctgccgcgtgccaagaagcttgagaaa
ctaggggtcttctcagcttgcaaggccaatgaaacctgcaagtgtaatggctggaaaaac
cccaagccccccaccgcaccccgcatggacctccagcagccagctgccaacctgagcgag
ttgtgccgtagctgtgagcaccctttggcggaccatgtgtcccacctggagaatgtgtca
gaggacgagattaaccggctcttgggaatggtagtagatgtagaaaatctgttcatgtct
gttcacaaggaagaggacacagacaccaaacaagtctatttctacctcttcaagctcttg
cggaagtgcattctgcagatgacacggccagtggtggaggggtctctaggcagcccccca
tttgagaagcctaacattgaacagggtgtactgaactttgtgcagtacaaatttagccac
ctggccccccgagagcgccagacaatgtttgagctctcaaagatgttcctgctctgcctt
aactactggaagctggagacccctgctcaattccggcagcggtcccagtctgaggatgtc
gctacctacaaagtcaattataccagatggctctgttactgccacgtgccccagagctgc
gacagcctcccccgctacgagaccacccacgtgtttggccgaagccttctacggtccatt
ttcactgtcacccgccggcagctactggaaaaatttcgggtggaaaaggacaaactggtg
cctgagaagaggaccctcatcctcactcacttccccaaattcctgtccatgcttgaggaa
gagatctacggggcaaattctcccatctgggagtcaggcttcaccatgccaccttcggag
gggacacagctggtgccccggccagccacggtcagtgcaacagttgtacccagcttcagt
ccttccatgggaggaggcagcaacagctccctgagcctagattccgcagggactgagccc
atgccagcaggggagaagaggaagcttcctgagaacctgaccctggaggatgccaagcgg
ctccgcgtgatgggggacatccccatggagctggtcaatgaggtcatgctgacgatcact
gaccccgctgccatgctggggcctgagacaagcctgctttcggccaacgcagctcgagat
gagacggctcgcctggaagaacggcgaggaatcatcgagttccacgtcattggcaactcc
ctgacgcccaaggccaaccggcgcgtgctgctctggctcgtggggctgcagaatgtcttt
tcccaccagctgccaagaatgcccaaggaatatatcgcccgcctcgtctttgacccgaag
cacaagaccctggccctgatcaaggatgggcgggtcatcggtggcatttgcttccgcatg
tttcccactcagggcttcacggaaatcgtcttctgtgccgtcacctcaaatgagcaggtc
aagggctatggcacccacctgatgaaccacctaaaggagtaccacatcaaacacagcatc
ctttactttctcacctatgctgacgagtacgccattggctacttcaaaaagcagggcttc
tccaaagacatcaaggtgcccaagagccgctatctgggctacatcaaggactatgaagga
gcgacgctgatggagtgtgagctgaatccccgaatcccctacacagagctgtcccacatc
atcaagaaacagaaagagatcatcaagaagttgattgagcgcaaacaggcacagatccgc
aaggtctaccctggactcagctgcttcaaagagggagtgaggcagatcccggtggagagc
gtccctggcattcgagagacaggctggaagccactgggaaaggagaagggcaaggagctt
aaggatcctgatcagctatatacgaccctcaaaaacctgctggctcagatcaagtcacac
cccagtgcctggcccttcatggaacctgtgaagaagtcagaggctcctgactactacgag
gttatccgtttccccattgacctgaagaccatgacagaacggttgcgcagtcgctactat
gtgacccggaagctcttcgtagctgacctgcagcgggtcatcgccaactgccgggagtac
aatcccccagacagcgaatactgtcgctgcgccagtgccctggagaagttcttctacttc
aagctcaaagagggagggctcatcgacaagtag

DBGET integrated database retrieval system