KEGG   Mus musculus (mouse): 14537Help
Entry
14537             CDS       T01002                                 

Gene name
Gcnt1, 5630400D21Rik, B130048E03, C2_GlcNAcT, C2GNT, IGnT
Definition
(RefSeq) glucosaminyl (N-acetyl) transferase 1, core 2 (EC:2.4.1.102)
  KO
K00727  
beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase [EC:2.4.1.102]
Organism
mmu  Mus musculus (mouse)
Pathway
Mucin type O-glycan biosynthesis
Metabolic pathways
Module
O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    14537 (Gcnt1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.102  beta-1,3-galactosyl-O-glycosyl-glycoprotein beta-1,6-N-acetylglucosaminyltransferase
     14537 (Gcnt1)
Glycosyltransferases [BR:mmu01003]
 Glycan extension
  O-Glycan
   14537 (Gcnt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
19 B; 19 12.75 cM
AA seq 428 aa AA seqDB search
MLRNLFRRRLFSCPTKYYFMLLVLSLITFSVLRIHQKPEFFSVRHLELAGDDPYSNVNCT
KILQGDPEEIQKVKLEILTVQFKKRPRRTPHDYINMTRDCASFIRTRKYIVEPLTKEEVG
FPIAYSIVVHHKIEMLDRLLRAIYMPQNFYCIHVDRKAEESFLAAVQGIASCFDNVFVAS
QLESVVYASWSRVKADLNCMKDLYRMNANWKYLINLCGMDFPIKTNLEIVRKLKCSTGEN
NLETEKMPPNKEERWKKRYTVVDGKLTNTGIVKAPPPLKTPLFSGSAYFVVTREYVGYVL
ENENIQKLMEWAQDTYSPDEFLWATIQRIPEVPGSFPSSNKYDLSDMNAIARFVKWQYFE
GHVSNGAPYPPCSGVHVRSVCVFGAGDLSWMLRQHHLFANKFDMDVDPFAIQCLDEHLRH
KALENLEH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaaacttgtttcggaggagacttttctcttgtcctacaaaatactactttatg
ctccttgtcctctctttaattaccttctctgttttaagaattcatcagaagcctgaattt
ttcagtgtcagacacttggagctggctggagatgatccttacagcaatgttaattgcacc
aagattttacagggtgacccagaagaaatccagaaggtgaagcttgagatactaacagtg
caattcaagaagcgcccgaggcggacaccccatgactatataaacatgacccgtgactgt
gcctctttcatcaggacacgcaaatatattgtggagccccttactaaagaagaggtaggc
tttccaattgcatattccattgtggttcatcataagattgaaatgcttgacaggctcctg
agggccatctatatgcctcagaatttctactgcattcacgtggacagaaaagcagaggaa
tcctttttagccgcggtgcagggcatcgcatcctgctttgataatgtctttgtggccagc
cagttggagagtgttgtttatgcgtcctggagtcgggttaaggcagacctcaactgcatg
aaggacctgtacagaatgaatgcaaactggaagtacttgatcaatctctgtggtatggat
ttccctattaaaaccaacctggaaattgtcaggaagctcaagtgctccacaggggaaaac
aacctggaaactgagaagatgcctcccaacaaggaagagagatggaaaaaaagatacacc
gttgtcgatgggaagctgaccaacactggaatagtcaaagcaccgcccccactgaaaact
cctctcttttcaggcagtgcctacttcgtggtcactagggaatatgtaggctacgtgctg
gaaaatgaaaatattcaaaagttgatggaatgggcacaggacacatacagcccagatgag
ttcctctgggccaccatccaaaggatcccagaagtccctggttctttcccctcaagcaac
aagtatgacttgtcagacatgaatgccattgctaggtttgtcaagtggcagtacttcgaa
ggccatgtttccaacggtgccccttatccaccgtgcagtggagtccacgtgcgctctgtg
tgcgtcttcggagctggtgacttgagctggatgctgcgccaacaccacctttttgccaat
aagtttgacatggatgtcgacccctttgccatccagtgtttggatgaacatctgaggcat
aaagccctggagaacttagaacactaa

DBGET integrated database retrieval system