KEGG   Mus musculus (mouse): 14563Help
Entry
14563             CDS       T01002                                 

Gene name
Gdf5, BMP-14, Cdmp-1, bp, brp
Definition
(RefSeq) growth differentiation factor 5
  KO
K04664  
growth differentiation factor 5
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
TGF-beta signaling pathway
Hippo signaling pathway
Module
BMP signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    14563 (Gdf5)
   04390 Hippo signaling pathway
    14563 (Gdf5)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    14563 (Gdf5)
Cytokines [BR:mmu04052]
 TGF-beta family
  GDF5 subfamily
   14563 (Gdf5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 H1; 2 77.26 cM
AA seq 495 aa AA seqDB search
MRLPKLLTLLLWHLAWLDLELICTVLGAPDLGQRTPGAKPGLTKAEAKERPPLARNVFRP
GGHIYGVGATNARAKGSSGQTQAKKDEPRKMPPRSGGPETKPGPSSQTRQAAARTVTPKG
QLPGGKASSKAGSAPSSFLLKKTREPGTPREPKEPFRPPPITPHEYMLSLYRTLSDADRK
GGNSSVKLEAGLANTITSFIDKGQDDRGPAVRKQRYVFDISALEKDGLLGAELRILRKKP
LDVAKPAVPSSGRVAQLKLSSCPSGRQPAALLDVRSVPGLDGSGWEVFDIWKLFRNFKNS
AQLCLELEAWERGRAVDLRGLGFERTARQVHEKALFLVFGRTKKRDLFFNEIKARSGQDD
KTVYEYLFSQRRKRRAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEA
FHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVV
YKQYEDMVVESCGCR
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgagactccccaaactcctcactcttttgctgtggcacctggcttggctggacctggaa
ctcatctgcactgtgctgggtgcccctgacttaggacagagaaccccaggggccaagcca
gggttgaccaaagcggaggccaaggagaggccacccctggccaggaatgtctttaggcca
gggggtcatatctatggtgtgggggccaccaatgccagggccaagggaagctctgggcag
acacaggccaagaaggatgaacccagaaagatgccccccagatccggtggccctgaaacc
aagccaggaccctcttcccagactagacaggctgcagcccggactgtaaccccaaaagga
cagcttcctgggggcaaagcatcttcaaaagcaggatctgcccccagctccttcctgctg
aagaagaccagggagcctgggacccctcgagagcccaaggagccgttccgcccgcccccc
atcacaccccacgaatacatgctctccctgtacaggacgctgtccgatgctgacagaaag
ggaggtaacagcagcgtgaagttggaggctggcctggccaacaccatcaccagctttatt
gacaaagggcaagatgaccgaggccctgcggtcaggaagcagaggtacgtgtttgacatc
agtgccttggagaaggatgggctgttgggggctgaactgcggatcttacggaagaagccc
ttggacgtggccaagccagcggtccccagtagcgggcgggttgcccaactgaagctgtcc
agctgccccagcggccggcagccggcagccttgctggatgtgcgctccgtgccaggcctg
gatggatctggctgggaggtgttcgacatctggaagctcttccgaaattttaagaactca
gcgcagctgtgcctggagctggaggcctgggaacggggccgggccgtggacctccgtggc
ctgggctttgaacgcactgcccgacaggtccacgagaaagccttgttcctagtgtttggt
cgtaccaagaaacgggacctgttctttaatgagattaaggcccgctctggccaggatgac
aagactgtgtatgaatatttgttcagccagcggcggaaacgccgggccccattggccaat
cgccagggcaagcgacccagcaagaacctcaaggctcgctgcagtcgcaaggccttgcat
gtcaacttcaaggacatgggctgggacgactggatcatcgcacctcttgagtatgaggcc
ttccactgcgaaggactgtgtgagttccccttgcgctcccacttggagcccacaaaccac
gcagtcattcagaccctaatgaactctatggaccctgaatccacaccacccacttgttgt
gtgcctacacggctgagtcctattagcatcctcttcatcgactctgccaacaacgtggtg
tataaacagtacgaggacatggtcgtggaatcttgtggctgcaggtag

DBGET integrated database retrieval system