KEGG   Mus musculus (mouse): 14582Help
Entry
14582             CDS       T01002                                 

Gene name
Gfi1b, Gfi-1B
Definition
(RefSeq) growth factor independent 1B
  KO
K09223  
growth factor independent 1
Organism
mmu  Mus musculus (mouse)
Brite
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    14582 (Gfi1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 A3
AA seq 330 aa AA seqDB search
MPRSFLVKSKKAHTYHQPRAQGDELVWPPAVIPVAKEHSQSASPLLSTPLPSQTLDWNTI
KQEREMLLNQSLPKMASAPEGPLVTPQPQDGESPLSESPPFYKPSFSWDTLASSYSHSYT
QTPSTMQSAFLERSVRLYGSPLVPSTESPLDFRLRYSPGMDTYHCVKCNKVFSTPHGLEV
HVRRSHSGTRPFACDVCGKTFGHAVSLEQHTHVHSQERSFECRMCGKAFKRSSTLSTHLL
IHSDTRPYPCQFCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTG
FKPFSCELCTKGFQRKVDLRRHRESQHNLK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgccacggtcctttctagtgaagagtaagaaggcacacacttaccaccagccccgggca
cagggtgatgagctggtctggcctcctgctgtaattcctgtggcaaaagagcatagccag
agtgccagccctcttctcagcacaccgcttccaagccagaccttggactggaacacaatc
aaacaggagcgggagatgttgctgaaccagagccttcccaagatggcctcagccccagag
gggcctctcgtgacaccccaaccccaggatggggaatcaccactctctgagtcaccccct
ttctacaagcccagcttctcctgggataccttggcctcctcctacagccacagctacaca
cagaccccctccaccatgcagtccgccttcctggagcgctccgtgaggctgtacggcagc
cccctcgtgcccagcacagagtctcccttggacttccgcctccgctactctccaggcatg
gacacttaccactgtgtcaagtgcaacaaggtgttctccacccctcatgggctagaagtg
catgtccgccgctctcacagcggaacccggccctttgcctgtgatgtctgtggcaaaacc
tttggccacgctgtgagcttggagcagcatactcacgtccactcacaggagcgaagcttc
gagtgccggatgtgtggcaaagccttcaagcgttcatccaccctgtccacccacctgctc
atccactcggacactcggccctacccctgccagttctgtgggaagcgcttccaccagaag
tcggacatgaagaaacacacctacatccacacaggtgagaagccccacaagtgccaggtg
tgtgggaaagccttcagccagagctccaacctcatcacccacagccgcaagcacacaggc
ttcaagccgttcagctgtgagctgtgcaccaagggcttccagcgcaaggtggacctgcga
cgtcaccgtgagagtcaacacaatctcaagtga

DBGET integrated database retrieval system