KEGG   Mus musculus (mouse): 14608Help
Entry
14608             CDS       T01002                                 

Gene name
Gpr83, AW045253, Gir, Gpr72, RP105, RP39, RP82
Definition
(RefSeq) G protein-coupled receptor 83
  KO
K04210  
G protein-coupled receptor 83
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14608 (Gpr83)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Neuropeptide
   Neuropeptide Y [OT]
    14608 (Gpr83)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 A2-A3; 9 4.4 cM
AA seq 423 aa AA seqDB search
MKVPPVLLLFLLSSVRATEQPQVVTEHPSMEAALTGPNASSHFWANYTFSDWQNFVGRRR
YGAESQNPTVKALLIVAYSFTIVFSLFGNVLVCHVIFKNQRMHSATSLFIVNLAVADIMI
TLLNTPFTLVRFVNSTWVFGKGMCHVSRFAQYCSLHVSALTLTAIAVDRHQVIMHPLKPR
ISITKGVIYIAVIWVMATFFSLPHAICQKLFTFKYSEDIVRSLCLPDFPEPADLFWKYLD
LATFILLYLLPLFIISVAYARVAKKLWLCNTIGDVTTEQYLALRRKKKTTVKMLVLVVVL
FALCWFPLNCYVLLLSSKAIHTNNALYFAFHWFAMSSTCYNPFIYCWLNENFRVELKALL
SMCQRPPKPQEDRLPSPVPSFRVAWTEKSHGRRAPLPNHHLPSSQIQSGKTDLSSVEPVV
AMS
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttcctcctgtcctgcttctctttcttctgtcctcagtgcgagctactgagcaa
ccgcaggtcgtcactgagcatcccagcatggaggcagccctgaccgggcccaacgcctcc
tcgcacttctgggccaactacactttctctgactggcagaacttcgtgggcaggagacgt
tatggggccgagtcccagaaccccacggtgaaagcactgctcatcgtggcctactcattc
accatcgtcttctcgctcttcggtaatgtcctggtctgtcatgtcatcttcaagaaccag
cgcatgcactcggccaccagcctcttcattgtcaacctggcagtggcggacatcatgatc
acattgctcaacacgcccttcactttggtccgctttgtgaacagcacatgggtgtttggg
aagggcatgtgtcatgtcagtcgctttgctcagtactgttctctacatgtctcagcactg
actctgacagctatcgcagtggaccgccaccaggtcatcatgcatccactgaagcctcgg
atctccatcaccaagggtgtcatatatattgctgtcatctgggtcatggctaccttcttc
tctctgccacatgccatctgccagaaactgtttaccttcaagtacagtgaggacattgtg
cgctccctctgcctgccggacttcccggagccagctgacctcttctggaagtatctggac
ctggccaccttcatcctgctctacctacttccactcttcattatctcagtggcctatgct
cgtgtggccaagaagctgtggctctgtaacaccattggcgacgtgaccacagagcagtac
ctcgccctgcgacgcaagaagaagaccaccgtgaagatgctggtgcttgtggtagtcctc
tttgccctctgctggttccctctcaactgctatgtcctcctcttgtccagcaaggccatc
cacaccaacaatgccctctactttgccttccactggtttgccatgagcagtacttgttat
aaccccttcatctactgctggctcaatgagaactttagggttgagcttaaggcattgctg
agcatgtgccaaaggccacccaagccgcaggaagacaggctaccctccccagttccttcc
ttcagggtggcatggacagagaagagccatggtcggagggctccactacctaatcaccac
ttgccctcttcccagatccagtctgggaagacagatctgtcatctgtggaacccgttgtg
gccatgagttag

DBGET integrated database retrieval system