KEGG   Mus musculus (mouse): 14626Help
Entry
14626             CDS       T01002                                 

Gene name
Gk2, GKTA, Gk-rs2
Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mmu00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:mmu03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
5 E3; 5 47.71 cM
AA seq 554 aa AA seqDB search
MAASKQTSAGPLVGAVVQGTNSTRFLVFNSKTAELVCSHQVELTQEYPKEGWVEQDPKEI
LKSVYECIAKACEKLAEVNIDISNIKAIGVSNQRETTVVWDKFTGDPLYNAVVWLDLRTQ
STVETLTKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNLRPIQKAVEEGRAMFGTIDS
WLIWCMTGGVNGGIHCTDVTNACRTMLFNIHSLEWDKDLCDFFEIPMSILPNVCSSSEIY
GLMTSGALEGVPISGCLGDQSAALVGQMCFHEGQAKNTYGTGCFLLCNTGQKCVFSEHGL
LTTLAYKLGKNKPVFYALEGSVAIAGAVIRWLRDNFEIITTSGEVENLAREVGTSYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREILDAMNRDCGIPLS
HLQVDGGMTNNRILMQLQADILHIPVVKSVMPETTALGAAMAAGAAEGVNVWSLEPEDLS
TILMERYEPQIQATESEIRFSTWKRAVMKSMGWVTAKDPENGDNPVFSCLPLGFFIVSSM
TLLIGARCVSTAEE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagcctcgaagcaaacctctgcgggaccgttggtaggagcggtggtccagggaacc
aactccactcgctttctagttttcaatagcaaaacagcagaactagtttgctctcatcag
gtggaactgacacaagaatacccaaaagaaggatgggtggagcaagaccccaaggaaatc
cttaaatctgtctatgagtgcatagcgaaagcttgtgagaaacttgctgaagtgaacatt
gatatttccaacattaaagctatcggcgtgagtaaccagcgggaaaccactgtggtctgg
gacaagttcacgggagaccctctgtacaatgccgtggtgtggcttgatctcagaacccag
tctactgtggagactctcactaagaaaatcccaggaaatagcaactttgtcaagtctaag
accggccttcctcttagcacttacttcagtgctgtgaagctgcggtggatgctggacaac
ctaagacccattcaaaaggctgttgaggaaggcagagccatgtttggaaccatcgactct
tggctcatctggtgtatgaccggaggagtcaatggaggcatccattgcaccgatgtaaca
aatgcatgcagaacgatgctttttaacatccactctttggaatgggataaagatctctgt
gacttttttgaaattccaatgagcatcctcccaaatgtatgcagttcttctgagatctat
ggcctgatgacatcaggggccttggaaggcgtgccaatatctggatgtttgggggatcag
tctgctgctttagtgggacaaatgtgtttccatgaaggtcaagccaaaaacacatacgga
acaggctgttttttactatgtaatacaggccagaaatgtgtgttttctgaacatggcctt
ctgaccacattggcttacaaactaggcaaaaataagccagttttttatgccttagaaggt
tctgttgctatagctggtgctgttattcgctggctaagagacaatttcgaaattataaca
acctcaggggaagttgaaaatcttgcaagagaggtaggcacttcctatggctgctacttt
gtcccagccttttcggggctgtatgcaccttactgggaacccagtgcaagagggataatc
tgtggtctcactcagttcaccaacaaatgccatattgcctttgctgcgttagaagctgtt
tgtttccaaacccgagagattttggatgccatgaatcgcgactgtggaattccactcagt
catttgcaggtcgatggaggaatgaccaacaacaggattcttatgcagctacaggcagat
attctgcacattccggtagttaagtctgtcatgcctgaaacgacggccctgggagctgcc
atggcagccggagctgcagaaggggtaaatgtttggagtcttgaacctgaagatttgtct
acgatcttgatggaacgatatgaaccacaaatccaagccacagagagtgaaattcgtttt
tcaacatggaagagagcagtgatgaagtcaatgggttgggttacagcaaaggaccctgaa
aatggcgataaccctgtcttctcttgtctgcccttgggtttttttatagtgagtagcatg
acgttattaattggagcaagatgtgtctcaactgctgaagagtaa

DBGET integrated database retrieval system