KEGG   Mus musculus (mouse): 14652Help
Entry
14652             CDS       T01002                                 

Gene name
Glp1r, GLP-1R, GLP1Rc
Definition
glucagon-like peptide 1 receptor
Orthology
K04581  
glucagon-like peptide 1 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Insulin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    14652 (Glp1r)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    14652 (Glp1r)
 Organismal Systems
  Endocrine system
   04911 Insulin secretion
    14652 (Glp1r)
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Pancreatic peptide
   Glucagon
    14652 (Glp1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
17 A3.3; 17 15.8 cM
AA seq 463 aa AA seqDB search
MASTPSLLRLALLLLGAVGRAGPRPQGTTVSLSETVQKWREYRRQCQRFLTEAPLLATGL
FCNRTFDDYACWPDGPPGSFVNVSCPWYLPWASSVLQGHVYRFCTAEGLWLHKDNSSLPW
RDLSECEESKRGERNFPEEQLLSLYIIYTVGYALSFSALVIASAILVGFRHLHCTRNYIH
LNLFASFILRALSVFIKDAALKWMYSTAAQQHQWDGLLSYQDSLGCRLVFLLMQYCVAAN
YYWLLVEGVYLYTLLAFSVFSEQRIFKLYLSIGWGVPLLFVIPWGIVKYLYEDEGCWTRN
SNMNYWLIIRLPILFAIGVNFLIFIRVICIVVSKLKANLMCKTDIKCRLAKSTLTLIPLL
GTHEVIFAFVMDEHARGTLRFIKLFTELSFTSFQGLMVAILYCFVNNEVQMEFRKCWERW
RLEHLNIQRDCSMKPLKCPTSSVSSGATVGSSVYAATCQSSYS
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccccaagcctcctgcgcctggcgctcctgctgctcggggcggtgggcagg
gccggcccccgccctcagggtaccacggtgtccctctcagagacggtgcagaaatggaga
gaataccggcggcagtgccagcgtttcctcacggaagcgccactcctggccacaggcctc
ttctgcaaccggacctttgatgactatgcctgctggccggatgggcccccaggttccttc
gtgaatgtcagctgcccctggtacctgccctgggccagtagtgtgctacaaggccatgtg
taccggttctgcacagctgagggtctctggctacataaggacaactccagcctgccctgg
agggacctgtcggagtgtgaagagtctaagcgaggggagagaaactttcctgaggaacag
ctcctgtccctgtacattatctacacagtggggtacgcactttctttctccgccttggtc
atcgcttcagccatccttgttggcttcagacacttgcactgcaccaggaactacatccac
ctgaacctgtttgcatccttcatcctccgagcactgtccgtcttcatcaaagatgctgcc
ctcaagtggatgtatagcacggctgcccagcaacaccagtgggatgggctcctctcctat
caggactctctaggctgccgactggtgttcctgctcatgcagtactgcgtggcagccaac
tactactggttgctggtggaaggcgtgtatctatacacactgctggccttctcggtgttc
tcggagcagcgcatcttcaagctgtatctgagcataggctggggagttccgctgctgttc
gttatcccatgggggattgtcaagtatctctatgaggacgagggctgctggactaggaac
tccaatatgaactactggctcatcatccgattgcccattctctttgctatcggcgtcaac
tttcttatcttcatccgtgtcatctgcatagtggtctccaaactgaaggctaatctcatg
tgcaagactgacatcaaatgcaggcttgccaagtccactctgactctcatcccccttctg
gggacacatgaagtcatctttgcctttgtgatggacgaacacgcccgaggaaccctacgc
ttcatcaagctgttcacagaactctccttcacttccttccagggcttgatggtggctatc
ctgtactgctttgtcaacaatgaggtccagatggagtttcggaaatgctgggagcgctgg
aggctggagcacttgaatatccagagagactgcagcatgaagcccctcaagtgtcccacc
agcagcgtcagcagtggggccacagtgggcagcagcgtgtacgcagccacctgccagagt
tcctacagctga

DBGET integrated database retrieval system