KEGG   Mus musculus (mouse): 14657Help
Entry
14657             CDS       T01002                                 

Gene name
Glra4
Definition
(RefSeq) glycine receptor, alpha 4 subunit
  KO
K05271  
glycine receptor alpha-4
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Cys-loop superfamily
  Glycine
   14657 (Glra4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X F1; X 59.1 cM
AA seq 456 aa AA seqDB search
MTTLVPASLFLLLWTLPGKVLLSVALAKEDVKSGLKGSQPMSPSDFLDKLMGRTSGYDAR
IRPNFKGPPVNVTCNIFINSFGSVTETTMDYRVNVFLRQQWNDPRLAYREYPDDSLDLDP
SMLDSIWKPDLFFANEKGANFHEVTTDNKLLRIFKNGNVLYSIRLTLILSCPMDLKNFPM
DIQTCTMQLESFGYTMNDLMFEWLEDAPAVQVAEGLTLPQFILRDEKDLGYCTKHYNTGK
FTCIEVKFHLERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQ
SSGSRASLPKVSYVKAIDIWMAVCLLFVFAALLEYAAVNFVSRQHKEFMRLRRRQRRQRM
EEDIIRESRFYFRGYGLGHCLQARDGGPMEGSSIYSPQPPTPLLKEGETMRKLYVDRAKR
IDTISRAVFPFTFLVFNIFYWVVYKVLRSEDIHQAL
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgacaactcttgttccagcaagcctcttccttcttctctggaccttgccagggaaggtc
ctgctcagtgtggctttggcaaaagaggatgtcaaatctggactcaaaggatcccagcct
atgtccccctctgatttcttggacaagcttatgggacgaacatctggatatgatgctagg
attaggcccaatttcaaaggtccacctgtgaatgtgacctgcaacatcttcatcaacagt
tttggctccgtcactgagaccaccatggactaccgggtaaatgtcttcttgcggcagcag
tggaatgacccacgtctggcctaccgagaatatccagatgactctctcgacctagaccca
tccatgctcgactctatctggaaaccagacctcttctttgccaatgagaaaggggccaac
ttccatgaggtgaccacagacaacaagttactgcgcatcttcaagaatggaaatgttctc
tacagcatcagattgaccctcattttgtcctgcccaatggacctcaagaacttcccaatg
gacatacagacctgtacaatgcagctggaaagctttggctacaccatgaatgacctcatg
tttgagtggctagaagatgctcctgctgtccaagtggctgaggggttgactctaccccaa
tttattttgcgggatgagaaggatctagggtattgtaccaagcactacaatacaggaaaa
ttcacttgcattgaggtaaagtttcacctggagcggcagatgggctactatctgattcaa
atgtacatccccagcctactcatcgtcatcctgtcctgggtctccttctggatcaacatg
gatgcggcccctgctcgtgtaggccttggcatcaccacagtcctcaccatgacaactcag
agctctggatccagggcctctttgcctaaggtgtcctacgtaaaggcaattgacatctgg
atggctgtatgcctgctctttgtatttgctgccttgcttgagtatgctgcagtcaatttt
gtctctcgtcagcataaggaatttatgagacttcgtagaaggcagagacgtcagcgtatg
gaagaagacatcataagagagagccgcttctattttcgtggctatggcctaggacactgc
ttacaagcaagggatggaggtccaatggaaggttccagcatttatagtccccaacctcca
acccctcttctaaaggaaggagaaaccatgaggaaactctatgtggaccgagccaagaga
attgacaccatctccagggctgtcttcccttttacttttcttgtcttcaatatcttctat
tgggttgtctataaagtactaaggtcagaagatatccaccaggcactgtga

DBGET integrated database retrieval system