KEGG   Mus musculus (mouse): 14660Help
Entry
14660             CDS       T01002                                 

Gene name
Gls, 6330442B14, AI314027, B230365M23Rik
Definition
glutaminase (EC:3.5.1.2)
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
mmu  Mus musculus (mouse)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Glutamatergic synapse
GABAergic synapse
Proximal tubule bicarbonate reclamation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    14660 (Gls)
   00330 Arginine and proline metabolism
    14660 (Gls)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    14660 (Gls)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    14660 (Gls)
  Nervous system
   04724 Glutamatergic synapse
    14660 (Gls)
   04727 GABAergic synapse
    14660 (Gls)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    14660 (Gls)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     14660 (Gls)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
1 C1.1; 1 26.86 cM
AA seq 674 aa AA seqDB search
MMRLRGSAMLRELLLRPPAAVGAVLRRAQPLGTLCRRPRGGSRPTAGLVAAARLHPWWGG
GGRAKGPGAGGLSSSPSEILQELGKGGTPPQQQQQQQQQPGASPPAAPGPKDSPGETDAF
GNSEGKEMVAAGDNKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTSDPRL
KECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHIDELY
ESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPLKYAI
AVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNNAEKF
DYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGILDFYF
QLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQFAFH
VGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYDNLRH
FAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALHVAAA
EGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDDG
KGNQTVHKNLDGLL
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgatgcggctgcgaggctcggcgatgctacgggagctgctcttaaggccgcccgccgcc
gtcggagccgtcctgcggcgcgcgcagcccctcggcacgctgtgccggcgcccccggggc
gggagccggccgaccgctggcctggtggccgctgcgcgactccacccgtggtggggcggg
ggcggccgcgcgaagggccccggcgcgggcggcctgtccagttcgccctcggagatccta
caggagctggggaaggggggtacgccgccacagcagcagcagcagcagcagcagcagcca
ggggcgtcgccacccgcagccccgggccccaaggacagcccgggggagaccgacgcgttc
ggcaacagcgagggcaaggagatggtggccgcgggcgacaataaaataaaacagggtctg
ttacctagcttggaagatttgctgttctatacaattgcagaaggacaagaaaagatacct
gttcacaagtttattacagcactcaaatctacaggattgcgaacatctgatcccaggttg
aaagagtgtatggatatgttaagattaactcttcagacaacgtcagatggtgtcatgcta
gacaaagatctttttaaaaagtgtgttcaaagcaacattgttttgttgacacaagcattt
agaagaaagtttgtcattcctgactttatgtcttttacctcacacatcgatgagttatat
gaaagtgctaaaaagcagtctggagggaaggttgctgattatattcctcagctggccaaa
ttcagtcctgatttgtggggtgtatctgtctgtactgtagatgggcaaaggcattctatt
ggagataccaaagttcctttttgtcttcagtcctgtgtaaaacccctgaaatatgcaatt
gctgttaatgacctgggaactgagtatgtacatcgctatgttgggaaggagccaagtgga
ttaagattcaacaaactctttttgaatgaagatgataaaccacataatcctatggtaaat
gctggagcaattgttgtgacttctctaataaagcaaggagtaaataatgctgagaagttt
gactacgtgatgcaatttttgaataagatggctggtaatgaatatgttggattcagtaat
gcaacgtttcagtctgaacgagaaagtggagatcgaaattttgcaataggatattactta
aaagaaaagaagtgttttccagaaggcacagacatggttgggatactagatttttacttc
cagctgtgctctattgaagtgacatgtgaatcagcaagtgtgatggctgccaccttggct
aatggtggtttctgcccaattactggtgaaagagtcctcagtcctgaggcagttcggaat
acactgagcttgatgcattcttgtggcatgtatgacttctcagggcagtttgcgttccat
gttggtcttcctgcaaaatctggagttgctgggggtattcttttagttgtccccaacgtc
atgggcatgatgtgttggtctcctcctcttgacaagatgggcaacagtgttaagggaatt
cacttttgtcacgatcttgtttctctgtgtaacttccataactatgataatttgagacac
tttgcaaaaaaacttgatcctcggagagaaggaggtgatcaaagggtgaagtcggtgata
aaccttctgtttgccgcatacactggagatgtgtctgccctccgaaggtttgctctgtca
gccatggacatggagcagcgggattatgactccagaacagccctccatgtcgcagcagca
gagggtcatgttgaagttgtcaagtttttgctggaagcttgcaaagtaaaccctttcccc
aaggacaggtggaataatacccccatggatgaagcactacactttggacaccatgatgtt
tttaaaatccttcaggaataccaagttcagtacacacctcaaggggattctgatgatgga
aagggaaaccagactgtccacaagaatctcgacgggttgctataa

DBGET integrated database retrieval system